Items where Year is 2023

Group by: Creators | Item Type | No Grouping
Jump to: A | B | C | D | E | F | G | H | I | J | K | L | M | N | O | P | R | S | T | U | V | W | Y | Z
Number of items: 1027.

A

ABIDIN, ANNISA (2023) IMPLEMENTASI MOBILISASI DINI PADA PASIEN DENGAN NYERI AKUT POST OPERASI LAPARATOMI DI RUANG BEDAH RSUD DR. H. ABDUL MOELOEK PROVINSI LAMPUNG TAHUN 2023. Diploma thesis, Poltekkes Kemenkes Tanjungkarang.

ADELIA, LIDIYA (2023) GAMBARAN KONDISI FISIK RUMAH PENDERITA PNEUMONIA PADA BALITA DI WILAYAH KERJA PUSKESMAS RAWAT INAP SUKARAJA KOTA BANDAR LAMPUNG TAHUN 2022. Diploma thesis, POLTEKKES KEMENKES TANJUNGKARANG.

ADELIA, MERTI (2023) ASUHAN KEPERAWATAN GANGGUAN KEBUTUHAN RASA AMAN DAN NYAMAN NYERI PADA PASIEN PASCA TONSILEKTOMI DI RUANGAN MAWAR RS DENKESYAH LAMPUNG TAHUN 2023. Diploma thesis, Poltekkes KemenkesTanjungkarang.

ADELLA, NIKEN MUTIARA (2023) GAMBARAN PENGETAHUAN DAN SIKAP MAHASISWA DALAM PENGGUNAAN ALAT PELINDUNG DIRI DI LABORATORIUM JURUSAN TEKNIK GIGI POLITEKNIK KESEHATAN TANJUNGKARANG TAHUN 2023. Diploma thesis, Poltekkes KemenkesTanjungkarang.

ADHISTY PUTRI, NADILA (2023) GAMBARAN CITARASA MAKANAN PADA MAKANAN LUNAK PASIEN RAWAT INAP KELAS II DI RSUD Dr. H. ABDUL MOELOEK PROVINSI LAMPUNG TAHUN 2023. Diploma thesis, POLTEKKES KEMENKES TANJUNGKARANG.

ADIANSYAH, ILHAM (2023) PENGARUH PSIKOEDUKASI TERHADAP RESPONS POST PARTUM BLUES PADA PASIEN POST OPERASI SEKSIO SESAREA DI RSIA ANUGERAH MEDIKAL CENTER KOTA METRO PROVINSI LAMPUNG TAHUN 2023. Diploma thesis, Poltekkes KemenkesTanjungkarang.

ADILA SUDRAJAT, NADIA (2023) GAMBARAN KEJADIAN DEMAM BERDARAH DENGUE DENGAN CURAH HUJAN DI WILAYAH KERJA PUSKESMAS BERINGIN RAYA. Diploma thesis, POLTEKKES KEMENKES TANJUNGKARANG.

ADINDA, NASYWA (2023) ASUHAN KEPERAWATAN JIWA DENGAN GANGGUAN KEBUTUHAN PSIKOSOSIAL PADA PASIEN RESIKO PERILAKU KEKERASAN DI RUANG MELATI RUMAH SAKIT JIWA PROVINSI LAMPUNG TAHUN 2023. Diploma thesis, Poltekkes Kemenkes Tanjungkarang.

AFIANDARI, RIRIN (2023) PEMBERIAN KOMPRES ALOEVERA UNTUK MENGURANGI NYERI PEMBENGKAKAN PAYUDARA DAN PENATALAKSANAAN POSISI MENYUSUI CRADLE HOLD TERHADAP NY. S DI PMB SITI JAMILA, S.ST LAMPUNG SELATAN. Diploma thesis, Poltekkes Kemenkes Tanjungkarang.

AFIFAH, NADILA (2023) GAMBARAN KEPATUHAN PENGGUNAAN OBAT ANTIHIPERTENSI PASIEN HIPERTENSI KOMORBIDITAS DIABETES MELITUS TIPE 2 DI RUMAH SAKIT PERTAMINA BINTANG AMIN LAMPUNG TAHUN 2022. Diploma thesis, Poltekkes KemenkesTanjungkarang.

AFRIDALIA, ANISA (2023) ASUHAN KEPERAWATAN PASIEN DENGAN NYERI AKUTPADA KASUS POST SECTIO CAESAREA PARTUS PREMATURUS IMMINENS TERHADAP Ny. S DI RUANG KEBIDANAN RSU HANDAYANI KOTABUMI LAMPUNG UTARA TANGGAL 28-30 MARET 2023. Diploma thesis, Poltekkes Kemenkes Tanjungkarang.

AFRILIA, ROSA (2023) GAMBARAN TINGKAT KEPUASAN MAKANAN BIASA PADA PASIEN RAWAT INAP DI RSUD ALIMUDDIN UMAR LAMPUNG BARAT TAHUN 2023. Diploma thesis, Poltekkes KemenkesTanjungkarang.

AFRIYANTI, LISA (2023) GAMBARAN KADAR KOLESTEROL TOTAL PADA PASIEN LAKI-LAKI DI PUSKESMAS HAJIMENA LAMPUNG SELATANTAHUN 2020-2021. Diploma thesis, Poltekkes Kemenkes Tanjungkarang.

AFRIZAL, BERLIANO (2023) GAMBARAN ASUPAN KALIUM, NATRIUM, DAN TEKANANDARAH PADA PENDERITA HIPERTENSI DI PUSKESMASLIWALAMPUNG BARAT TAHUN2023. Diploma thesis, POLTEKKES KEMENKES TANJUNGKARANG.

AG, UCI ANUARI (2023) GAMBARAN PERBANDINGAN FAKTOR PENGETAHUAN,KEBIASAAN MASYARAKAT DAN KEPADATAN JENTIK AEDES sp DI WILAYAH KERJA PUSKESMAS RAJABASA INDAH DAN PUSKESMAS KEBON JAHE TAHUN 2023. Diploma thesis, POLTEKKES KEMENKES TANJUNGKARANG.

AGISTY, LUNNA MARSHA (2023) KETERKAITAN ANTARA KEHILANGAN GIGI DENGAN FUNGSI KOGNITIF PADA LANSIA DI PANTI JOMPO TRESNA WERDHA TAHUN 2023. Diploma thesis, Poltekkes Kemenkes Tanjungkarang.

AGRIYANTI, DESTIA (2023) GAMBARAN DAGUSIBU OBAT ANTIBIOTIK DI MASYARAKAT PEKON KEMBAHANG KECAMATAN BATU BRAK KABUPATEN LAMPUNG BARAT TAHUN 2023. Diploma thesis, Poltekkes KemenkesTanjungkarang.

AGUSTA, RYAN (2023) GAMBARAN KONSUMSI SAYUR DAN BUAH PADA SISWA KELAS 5-6 DI SEKOLAH DASAR NEGERI 01 HAJIMENA KECAMATAN NATAR LAMPUNG SELATAN TAHUN 2023. Diploma thesis, POLTEKKES KEMENKES TANJUNGKARANG.

AGUSTEEN, FADILAH (2023) ASUHAN KEPERAWATAN GANGGUAN KEBUTUHAN AMAN NYAMAN NYERI PADA PASIEN POST PARTUM SECTIO CAESAREA DI RUANG ANGGREK RS TK IV 02.07.04 DENKESYAH 02.04.03 KOTA BANDAR LAMPUNG TAHUN 2023. Diploma thesis, Poltekkes KemenkesTanjungkarang.

AGUSTIEN, SALSA FADILA (2023) GAMBARAN FAKTOR -FAKTOR YANG MEMPENGARUHI KECEMASAN PASIEN PADA TINDAKAN EKSTRAKSI GIGI DI PUSKESMAS PUNGGUR TAHUN 2023. Diploma thesis, Poltekkes Kemenkes Tanjungkarang.

AGUSTIN, AUDIE PUTRI (2023) GAMBARAN FAKTOR – FAKTOR YANG BERHUBUNGANDENGANKEKURANGANENERGI KRONIS (KEK) PADA IBU HAMIL DI WILAYAH KERJAPUSKESMAS RAWAT INAP MULYA ASRI TULANGBAWANG BARAT TAHUN2023. Diploma thesis, Poltekkes Kemenkes Tanjungkarang.

AGUSTIN, FAULA REGINA (2023) PERBANDINGAN EFEKTIFITAS PENYULUHAN KESEHATAN GIGI METODE STORYTELLING DENGAN METODE ROLEPLAY PADA SISWA KELAS 3 SDN 1 RAJABASA TAHUN 2023. Diploma thesis, Poltekkes Kemenkes Tanjungkarang.

AGUSTIN, VIOLA TANTRI (2023) ASUHAN KEPERAWATAN JIWA GANGGUAN PEMENUHAN KEBUTUHAN PSIKOSOSIAL HALUSINASI PADA PASIEN SKIZOFRENIA DI RUANG NURI RUMAH SAKIT JIWA DAERAH PROVINSI LAMPUNG TAHUN 2023. Diploma thesis, Poltekkes KemenkesTanjungkarang.

AGUSTINA, ERNY (2023) IMPLEMENTASI TERAPI RELAKSASI GENGGAM JARI PADA PASIEN DENGAN NYERI AKUT POST OPERASI HERNIOTOMI DI RS MARDI WALUYO METRO TAHUN 2023. Diploma thesis, Poltekkes Kemenkes Tanjungkarang.

AGUSTINA, ERNY (2023) PERBEDAAN PENGARUH TERAPI MUSIK KLASIK MOZART DAN INSTRUMENTAL KITARO KOI TERHADAP KUALITAS TIDUR PASIEN PRE OPERASI DI RSUD DR. H. ABDUL MOELOEK PROVINSI LAMPUNG TAHUN 2022. Diploma thesis, Poltekkes Kemenkes Tanjungkarang.

AGUSTINA, MARLIA (2023) PERBANDINGAN JUMLAH LEUKOSIT ANTARA TITER WIDAL 1/160 DAN 1/320 PADA PASIEN DEMAM TIFOID DI PUSKESMAS GEDONG AIR. Diploma thesis, Poltekkes KemenkesTanjungkarang.

AGUSTINA, RINA (2023) GAMBARAN ASUPAN ZAT GIZI MAKRO, AKTIVITAS FISIK, PENGETAHUAN DAN SIKAP DENGAN STATUS OBESITAS SENTRAL PADA PEGAWAI RUMAH SAKIT ISLAM METRO. Diploma thesis, Poltekkes KemenkesTanjungkarang.

AGUSTINA, SHERLY (2023) GAMBARAN RUMAH SEHAT DI KELURAHAN FAJAR BARU KECAMATAN PAGELARAN UTARA KABUPATEN PRINGSEWU TAHUN 2023. Diploma thesis, POLTEKKES KEMENKES TANJUNGKARANG.

AILANI, ARLA APRILIA (2023) PERSEPSI DISTRIBUSI DAN CITA RASA MAKANAN BIASA PADA PASIEN KELAS III DI RSU MUHAMMADIYAH METRO TAHUN 2023. Diploma thesis, POLTEKKES KEMENKES TANJUNGKARANG.

AINA, RIZKA (2023) GAMBARAN PENYALAHGUNAAN OBAT BATUK KOMIX PADA REMAJA DI PUSKESMAS BENGKUNAT KECAMATAN NGARAS KABUPATEN PESISIR BARAT. Diploma thesis, Poltekkes KemenkesTanjungkarang.

AINI, AYU FAUZIAH (2023) PENERAPAN TEKNIK PIJAT OKSITOSIN DALAM UPAYA MEMPERLANCAR PENGELUARAN ASI PADA IBU POSTPARTUM TERHADAP NY. S DI PMB NURHIDAYAH A.Md.Keb LAMPUNG SELATAN. Diploma thesis, Poltekkes Kemenkes Tanjungkarang.

AINUN, RIDHA CAHYA (2023) PEMBUATAN GIGI TIRUAN SEBAGIAN LEPASAN AKRILIK PADA GIGI 36 DAN 46 DENGAN KASUS EKTRUSI GIGI 16. Diploma thesis, Poltekkes KemenkesTanjungkarang.

AINURROFIQOH, HANAN NAILA (2023) HUBUNGAN HYGIENE DAN SANITASI LINGKUNGAN DENGAN KEJADIAN SCABIES PADA PONDOK PESANTREN AL – GHIFARI KECAMATAN BATANGHARI KABUPATEN LAMPUNG TIMUR TAHUN 2023. Diploma thesis, POLTEKKES KEMENKES TANJUNGKARANG.

AKTIANI, RATI (2023) HUBUNGAN PERILAKU PEMBERANTASAN SARANG NYAMUK (PSN) DENGAN KEJADIAN DEMAM BERDARAH DENGUE (DBD) DI WILAYAH KERJA PUSKESMAS SATELIT KECAMATAN KEDAMAIAN KOTA BANDAR LAMPUNG TAHUN 2023. Diploma thesis, Poltekkes Kemenkes Tanjung Karang.

AL IMRONI, M.FADIL (2023) GAMBARAN JAMUR Dermatofita PADA HELM OJOL DI KECAMATAN KEDATON BEDASARKAN LAMA PEMAKAIAN TAHUN 2023. Diploma thesis, Poltekkes KemenkesTanjungkarang.

ALFIATURROHMI, ALFIATURROHMI (2023) PENGARUH PIJAT REFLEKSI KAKI TERHADAP PENURUNAN INTENSITAS NYERI PADA IBU POST OPERASI SECTIO CAESAREA DI RSIA ANUGERAH MEDICAL CENTER KOTA METRO PROVINSI LAMPUNG TAHUN 2023. Diploma thesis, Poltekkes KemenkesTanjungkarang.

ALFINA, RELY (2023) HUBUNGAN SELF EFFICACY DAN FAMILYSUPPORTDENGAN KEMANDIRIAN ACTIVITY OF DAILY LIVING(ADL) PADA PASIEN POST OPERASI SECTIO CAESAREA DI RSIA ANUGERAH MEDICAL CENTER KOTA METRO TAHUN 2023. Diploma thesis, Poltekkes Kemenkes Tanjungkarang.

ALFIRO NURSHAFA'AT, SHERLY (2023) PEMANFAATAN SAMPAH BOTOL PLASTIK BEKAS DAN KRESEK SEBAGAI BAHAN PEMBUATAN PAVING BLOCK TAHUN 2023. Diploma thesis, POLTEKKES KEMENKES TANJUNGKARANG.

ALHAMMAMI, ALIFA (2023) PENGARUH PENGATURAN POSISI TIDUR PASIEN TERHADAP PERUBAHAN PERISTALTIK USUS PASIEN POST OPERASI DENGAN ANESTESI UMUM DI RUMAH SAKIT ABDUL MOELOEK PROVINSI LAMPUNG. Diploma thesis, Poltekkes KemenkesTanjungkarang.

ALHAMMAMI, ALIFA (2023) PENGARUH PENGATURAN POSISI TIDUR PASIEN TERHADAP PERUBAHAN PERISTALTIK USUS PASIEN POST OPERASI DENGAN ANESTESI UMUM DI RUMAH SAKIT ABDUL MOELOEK PROVINSI LAMPUNG. Diploma thesis, Poltekkes KemenkesTanjungkarang.

ALI, LUTFIYYAH NURJIHAN (2023) MANAJEMEN RESIKO PADA PENGELOLAAN LIMBAH MEDIS BAHAN BERBAHAYA BERACUN (B3) DI RUMAH SAKIT MUHAMADIYAH METRO TAHUN 2023. Diploma thesis, Poltekkes Tanjungkarang.

ALIFFIA, JEANNIETA HASTY (2023) GAMBARAN POLA MAKAN, ASUPAN GIZI, STATUS GIZI DAN PENGETAHUAN GIZI PADA IBU HAMIL YANG MELAKUKAN ANC DI PUSKESMAS RAWAT INAP SUKABUMIKOTA BANDAR LAMPUNG TAHUN 2023. Diploma thesis, POLTEKKES KEMENKES TANJUNGKARANG.

ALKAUSAR, MUHAMMAD ALFAN (2023) PENGARUH FREKUENSI LATIHAN RANGE OF MOTION(ROM)PASIF DAN AKTIF TERHADAP KEKUATANOTOT PADA PASIEN POST OPERASI FRAKTUREKSTREMITAS BAWAH DI RSUDDr. H. ABDUL MOELOEK PROVINSI LAMPUNG TAHUN 2023. Diploma thesis, Poltekkes Kemenkes Tanjungkarang.

ALKAZAM, ROAINI (2023) GAMBARAN PENGGUNAAN ALAT PELINDUNG DIRI PADA PEKERJA BAGIAN PRODUKSI DI PT.GREAT GIANT PINEAPPLE PG 04 LAMPUNG TIMUR TAHUN 2023. Diploma thesis, POLTEKKES KEMENKES TANJUNGKARANG.

ALMIRAYANI, ALMIRAYANI (2023) ASUHAN KEPERAWATAN NYERI AKUTDENGAN INTERVENSI KEPERAWATAN NECK STRECTHING EXERCISE PADA PASIEN POST OP SNNT DI RUMAH SAKIT BHAYANGKARA BANDAR LAMPUNG. Diploma thesis, Poltekkes Kemenkes Tanjungkarang.

ALPHA, MUHAMMAD DHANI (2023) GAMBARAN FASILITAS SANITASI MASJID DI WILAYAH KECAMATAN METRO UTARA KOTA METRO TAHUN 2023. Diploma thesis, POLTEKKES KEMENKES TANJUNGKARANG.

ALSY, ALYA YUS’R (2023) GAMBARAN PERILAKU PICKY EATER DAN STATUS GIZI ANAK TK AL-AZHAR 16 BANDAR LAMPUNG. Diploma thesis, POLTEKKES KEMENKES TANJUNGKARANG.

ALTA, SHAFIRA SALSABILLA (2023) ASUHAN KEPERAWATAN GANGGUAN OKSIGENASI PADA KASUS TUBERKULOSIS PARU TERHADAP Tn.K DI RUANG FRESIA RSU HANDAYANI KOTABUMI LAMPUNG UTARA 11 - 13 NOVEMBER 2022. Diploma thesis, Poltekkes Kemenkes Tanjungkarang.

ALVINA, RAHMA (2023) ASUHAN KEPERAWATAN DENGAN GANGGUAN KEBUTUHAN OKSIGENASI PADA KASUS POST KRANIOTOMI e.c STROKE HEMORAGIK TERHADAP Tn. T DI RUANG ICU RSUD JENDERAL AHMAD YANI METRO TANGGAL 14-15 OKTOBER 2022. Diploma thesis, Poltekkes Kemenkes Tanjungkarang.

ALYA, RAHMA (2023) GAMBARAN FAKTOR PENYEBAB STOMATITIS PADA IBU-IBU PEMAIN VOLI DI BKP TAHUN 2023. Diploma thesis, Poltekkes Kemenkes Tanjungkarang.

AMALIA, JUNICA PANCA (2023) GAMBARAN PERILAKU PICKY EATING, ASUPAN GIZI, DAN STATUS GIZI PADA ANAK BALITA DI DESA TRIMODADI KABUPATEN LAMPUNG UTARA TAHUN 2023. Diploma thesis, POLTEKKES KEMENKES TANJUNGKARANG.

AMALIA, PUTRI (2023) ASUHAN KEPERAWATAN PASIEN DENGAN GANGGUAN KESEIMBANGAN CAIRAN PADA KASUS GLOMERULONEFIRITIS AKUT PASCA STREPTOKOKUS (GNAPS) TERHADAP AN.H DI RUANG EDELWEIS RSU HANDAYANI KOTABUMI LAMPUNG UTARA TANGGAL 14-16 MARET 2023. Diploma thesis, Poltekkes Kemenkes Tanjungkarang.

AMANDA, SALSABILA (2023) ASUHAN KEPERAWATAN GAWAT DARURAT DENGAN GANGGUAN OKSIGENASI PADA KASUS CEDERA KEPALA BERAT TERHADAP Tn.K DI RUANG IGD RSUD JENDRAL AHMAD YANI METRO TANGGAL 01 N0VEMBER 2022. Diploma thesis, Poltekkes Kemenkes Tanjungkarang.

AMAREL, AQILLA FADYA (2023) ASUHAN KEPERAWATAN TERHADAP NY. A DENGAN GANGGUAN MOBILITAS FISIK PADA KASUS POST SECTIO CAESAREA DI RUANG KEBIDANAN RSU HANDAYANI KOTABUMI, KABUPATEN LAMPUNG UTARA TANGGAL 27-29 MARET 2023. Diploma thesis, Poltekkes Kemenkes Tanjungkarang.

AMARETA, ADISTYA (2023) PENERAPAN PIJAT ENDORPHIN TERHADAP NYERI PUNGGUNG PADA NY. S HAMIL TRIMESTER III DI PMB SITI ROHMAH. Diploma thesis, Poltekkes Tanjungkarang.

AMEILIA, RANI (2023) PEMBERIAN AROMATERAPI PEPPERMINT UNTUK MENGATASI MUAL DAN MUNTAH PADA IBU HAMIL TRIMESTER 1 TERHADAP NY. M DI PMB RAHAYU. Diploma thesis, Poltekkes Tanjungkarang.

AMELIA, RIA (2023) ASUHAN KEBIDANAN PADA IBU NIFAS DENGAN LUKA HECTING PERINEUM DI TEMPAT PRAKTIK MANDIRI BIDAN YULIASARI KECAMATAN LAMBU KIBANG KABUPATEN TULANG BAWANG BARAT. Diploma thesis, Poltekkes Tanjungkarang.

AMELIA, RISKA (2023) GAMBARAN PENGETAHUAN, SIKAP, DAN PERILAKU PENJAMAH MAKANAN DALAM PENERAPAN HYGIENE DAN SANITASI PENYELENGGARAN MAKANAN DI INSTALASI GIZI RUMAH SAKIT JIWA PROVINSI LAMPUNG. Diploma thesis, Poltekkes Kemenkes Tanjungkarang.

AMELIA, SALSA JAHRA (2023) GAMBARAN PENGELOLAAN LIMBAH MEDIS PADAT DI RUMAH SAKIT WISMA RINI PRINGSEWU TAHUN 2023. Diploma thesis, POLTEKKES KEMENKES TANJUNGKARANG.

AMELIA S., RAHMA GUSTI (2023) FORMULASI SEDIAAN FILM STRIP EKSTRAK ETANOL DAUN SALAM (Syzygium polyanthum (Wight) Walp) DENGAN VARIASI KONSENTRASI EKSTRAK. Diploma thesis, Poltekkes KemenkesTanjungkarang.

AMILIA, RISKA (2023) PERBEDAAN EFEKTIVITAS AROMATERAPI ROSE ESSENTAIL OIL DAN LAVENDER ESSENTAIL OIL TERHADAP KECEMASAN PASIEN PRE OPERASI DI RSUD H. ABDUL MOELOEK PROVINSI LAMPUNG TAHUN 2023. Diploma thesis, Poltekkes KemenkesTanjungkarang.

AMIRA, SILVA (2023) GAMBARANPREFERENSISAYURDANBUAHPADASISWA KELAS5DISDN2PERUMNASWAYKANDIS BANDARLAMPUNG2023. Diploma thesis, POLTEKKES KEMENKES TANJUNGKARANG.

AMRI, MUNALIU (2023) FAKTOR-FAKTOR YANG BERHUBUNGAN DENGAN PEMBERIANASI DI WILAYAH KERJA PUSKESMAS NEGARA RATU KECAMATAN SUNGKAI UTARA KABUPATEN LAMPUNG UTARA TAHUN 2023. Diploma thesis, POLTEKKES KEMENKES TANJUNGKARANG.

ANANTA KURNIAWAN, DINI (2023) ASUHAN KEBIDANAN PADA IBU HAMIL DENGAN EMESIS GRAVIDARUM DI TEMPAT PRAKTIK MANDIRI BIDAN P MARGOREJO KOTA METRO. Diploma thesis, Poltekkes Tanjungkarang.

ANATASIA, BELA (2023) GAMBARAN TEKANAN DARAH, STATUS OBESITAS, AKTIFITAS FISIK, KONSUMSI GORENGAN DAN KEBIASAAN MEROKOK PADA PASIEN HIPERTENSI RAWAT JALAN DI PUSKESMAS KOTAAGUNG KABUPATEN TANGGAMUS TAHUN 2023. Diploma thesis, Poltekkes Kemenkes Tanjungkarang.

ANDANI, NEPIRA PUTRI (2023) PENATALAKSANAAN ASUHAN GIZI TERSTANDAR PADA PASIEN PENDERITA DIABETES MELITUS TIPE 2 DI RUMAH SAKIT UMUM MUHAMMADIYAH METRO TAHUN 2023. Diploma thesis, Poltekkes Kemenkes Tanjungkarang.

ANDANI, TANDOK (2023) ASUHAN KEPERAWATAN GANGGUAN KEBUTUHAN NUTRISI PADA PASIEN HEPATITIS B DI RUMAH SAKIT BHAYANGKARA POLDA LAMPUNG TAHUN 2023. Diploma thesis, Poltekkes KemenkesTanjungkarang.

ANDANIA, AGRIFISTA JULIA (2023) KAJIAN PEMBUATAN STICK KUE BAWANG DENGAN SUBSTITUSI TEPUNG HATI AYAM SEBAGAI MAKANAN SELINGAN TINGGI ZAT BESI. Diploma thesis, POLTEKKES KEMENKES TANJUNGKARANG.

ANDERIYAN, HARTASYA RACHMADANI (2023) UJI EKSTRAK DAUN RAMBUTAN (NEPHELIUM LAPPACEUM L) DALAM MEMBUNUH LARVA NYAMUK AEDES AEGYPTIINSTAR III. Diploma thesis, POLTEKKES KEMENKES TANJUNGKARANG.

ANDINI, AJENG (2023) PERBANDINGAN LAJU ENDAP DARAH DAN JUMLAH LEUKOSIT ANTAR DERAJAT DISMENOREA PADA MAHASISWI JURUSAN TEKNOLOGI LABORATORIUM MEDIS POLTEKKES TANJUNGKARANG. Diploma thesis, Poltekkes KemenkesTanjungkarang.

ANDINI, DELIA (2023) GAMBARAN PELAKSANAAN KESEHATAN DAN KESELAMATAN KERJA (K3) DI RSD MAYJEND H.M RYACUDU KOTABUMI KABUPATEN LAMPUNG UTARA TAHUN 2023. Diploma thesis, POLTEKKES KEMENKES TANJUNGKARANG.

ANDINI, FEBYLA PUTRI (2023) ASUHAN KEPERAWATAN KELUARGA DENGAN GANGGUAN AMAN DAN NYAMAN PADA KASUS FEBRIS TERHADAP AN.A DI DESA GUNUNG ANGGER WILAYAH KERJA PUSKESMAS KOTABUMI II TANGGAL 07 – 09 NOVEMBER 2022. Diploma thesis, Poltekkes Kemenkes Tanjungkarang.

ANDINI, FEMY (2023) ASUHAN KEPERAWATAN DENGAN GANGGUAN KEBUTUHAN AKTIVITAS PADA PASIEN HIPERTENSI DI WILAYAH KERJA PUSKESMAS HAJIMENA TAHUN 2023. Diploma thesis, Poltekkes KemenkesTanjungkarang.

ANDINI, VANY BELA (2023) GAMBARAN HASIL PEMERIKSAAN CROSSMATCH PADA PENDERITA GAGAL GINJAL KRONIK (GGK) DI UTD RSUD Dr. H. ABDUL MOELOEK TAHUN 2022. Diploma thesis, Poltekkes KemenkesTanjungkarang.

ANDIRA, SHELVIA SUKMA WAHYU (2023) EFEKTIFITAS BRIKET TONGKOL JAGUNG DAN SERBUK GERGAJI SEBAGAI BAHAN BAKAR ALTERNATIF PENGGANTI MINYAK TANAH TAHUN 2023. Diploma thesis, POLTEKKES KEMENKES TANJUNGKARANG.

ANDRIANI, RISMA DHEA (2023) GAMBARAN PENGELOLAAN SAMPAH PASAR TRADISIONAL DI PASAR SENTRAL, PASAR DEKON, DAN PASAR PAGI KOTABUMI KABUPATEN LAMPUNG UTARA TAHUN 2023. Diploma thesis, POLTEKKES KEMENKES TANJUNGKARANG.

ANGELINA, NATASYA (2023) HUBUNGAN PERSONAL HYGIENE DENGAN KEJADIAN SKABIES DI BEDENG KM 8 PT SWEET INDOLAMPUNG KABUPATEN TULANG BAWANG. Diploma thesis, Poltekkes Kemenkes Tanjungkarang.

ANGELITA, DESPANI (2023) ASUHAN KEPERAWATAN GERONTIK DENGAN GANGGUAN KEBUTUHAN AMAN NYAMAN PADA KASUS GOUT ARTHRITIS TERHADAP NY. N DI DESA MULANG MAYA WILAYAH KERJA PUSKESMAS KOTABUMI II KABUPATEN LAMPUNG UTARA TANGGAL 24-27 OKTOBER 2022. Diploma thesis, Poltekkes Kemenkes Tanjungkarang.

ANGGARA, HENGKI (2023) GAMBARAN KEJADIAN MEDICATION ERROR PADA FASE PRESCRIBING DAN DISPENSING PASIEN RAWAT JALAN DI RS PERTAMINA BINTANG AMIN BANDAR LAMPUNG PROVINSI LAMPUNG. Diploma thesis, Poltekkes KemenkesTanjungkarang.

ANGGARA, SABIQ RAFI ARHAB (2023) PENERAPAN TEKNIKGUIDED IMAGERY UNTUK MENGATASI MASALAH KEPERAWATAN NYERI AKUT PADA PASIEN ULKUS DIABETIKUM POST DEBRIDEMENT DI RS MARDI WALUYO KOTAMETRO TAHUN2023. Diploma thesis, Poltekkes Kemenkes Tanjungkarang.

ANGGARA, SABIQ RAFI ARHAB (2023) PENGARUH EDUKASI ROM AKTIF KOMBINASI MEDIA BOOKLET DAN DEMONSTRASI TERHADAP KEMAMPUAN MOBILISASI EKTREMITAS PADA PASIEN POST OPERASI FRAKTUR DI RSUD DR. HI. ABDUL MOELOEK TAHUN 2022. Diploma thesis, Poltekkes Kemenkes Tanjungkarang.

ANGGRAINI, ALITA MERINDA (2023) PENGARUH TERAPI STORYTELLING TERHADAPKECEMASAN PREOPERASIPADA ANAKUSIAPRASEKOLAH DI RSUD Dr.H. ABDUL MOELOEKPROVINSI LAMPUNG TAHUN 2023. Diploma thesis, Poltekkes Kemenkes Tanjungkarang.

ANGGRAINI, DIAN ANGGI (2023) PEMBUATAN GIGI TIRUAN SEBAGIAN LEPASAN AKRILIK KEHILANGAN GIGI 36, 46 DENGAN KASUS LINGGIR 46 YANG SEMPIT (LAPORAN KASUS). Diploma thesis, Poltekkes KemenkesTanjungkarang.

ANGGRAINI, FADHILLAH (2023) GAMBARAN FAKTOR-FAKTOR YANG BERHUBUNGAN DENGAN PARTISIPASI IBU DALAM PENIMBANGAN BALITA DI POSYANDU WILAYAH KERJA PUSKESMAS SUKABUMI BANDAR LAMPUNG TAHUN 2023. Diploma thesis, Poltekkes Kemenkes Tanjungkarang.

ANGGRAINI, INTAN (2023) ASUHAN KEPERAWATAN GANGGUAN KEBUTUHAN OKSIGEN PADA PASIEN PNEUMONIA DI RUANG ICU RSUD Dr. H. ABDUL MOELOEK PROVINSI LAMPUNG TAHUN 2023. Diploma thesis, Poltekkes KemenkesTanjungkarang.

ANGGRAINI, MARISHA (2023) GAMBARAN SANITASI DI SEKOLAH DASAR NEGERI WILAYAH KERJA PUSKESMAS KENALI KECAMATAN BELALAU KABUPATEN LAMPUNG BARAT PADA TAHUN 2023. Diploma thesis, POLTEKKES KEMENKES TANJUNGKARANG.

ANGGRAINI, NUR DEWI (2023) HUBUNGAN LAJU FILTRASI GLOMERULUS DENGAN KADAR PROTEIN URINE PADA PASIEN PENYAKIT GINJAL KRONIK DI RUMAH SAKIT PERTAMINA BINTANG AMIN. Diploma thesis, Poltekkes Kemenkes Tanjungkarang.

ANGGRAINI, VERONICA (2023) PENGARUH MURROTAL AL QUR’AN SURAH AR RAHMAN TERHADAP PENURUNAN INTENSITAS NYERI PADA PASIEN POST OPERASI LAPARATOMY DI RSUD JENDRAL AHMAD YANI DI KOTA METRO TAHUN 2023. Diploma thesis, Poltekkes KemenkesTanjungkarang.

ANGGUN, SAE (2023) JAMUR Aspergillus sp. PADA BUMBU KACANG PEDAGANG PECELDAN BUMBU KACANG KEMASAN TIDAK BERMERK YANGDIJUALDIPASARPERUMNAS WAYHALIM KOTABANDARLAMPUNG. Diploma thesis, Poltekkes Kemenkes Tanjungkarang.

ANGKONANDO, ADI (2023) PENGARUH PEMBERIAN RELAKSASI GUIDED IMAGERY MUSIC TERHADAP TINGKAT KECEMASAN PASIEN PRE OPERASI SECTIO CAESAREA DI RSIA ANUGERAH MEDICAL CENTER KOTA METRO TAHUN 2023. Diploma thesis, Poltekkes KemenkesTanjungkarang.

ANGRAINI, RADA (2023) ASUHAN KEBIDANAN TUMBUH KEMBANG PADA ANAK DENGAN MOTORIK HALUS MERAGUKAN DI TEMPAT PRAKTIK MANDIRI BIDAN ROSMIANAH, KARTARAHARJA TULANG BAWANG BARAT. Diploma thesis, Poltekkes Tanjungkarang.

ANI, EVI SHEPTY (2023) ASUHAN KEPERAWATAN GANGGUAN SIRKULASI PADA KASUS CONGESTIVE HEART FAILURE (CHF) TERHADAP TN. E DI RUANG FREESIA RSU HANDAYANI KOTABUMI LAMPUNG UTARA TANGGAL 10-12 OKTOBER 2022. Diploma thesis, Poltekkes Kemenkes Tanjungkarang.

ANIDA, MUTIARA AYU (2023) ASUHAN KEBIDANAN PADA BALITA DENGAN KETERLAMBATAN PERKEMBANGAN PADA ASPEK SOSIALISASI DAN KEMANDIRIAN DI PRAKTIK MANDIRI BIDAN MARGA KENCANA TULANG BAWANG BARAT. Diploma thesis, Poltekkes Tanjungkarang.

ANISA, IRMA (2023) ASUHAN KEPERAWATAN GANGGUAN KEBUTUHAN OKSIGENASI PADA PASIEN EFUSI PLEURA DAN PASIEN CKD DI RUANG ICU RSUD Dr. H. ABDUL MOELOEK TAHUN 2023. Diploma thesis, Poltekkes KemenkesTanjungkarang.

ANISA, PITRI (2023) UJI EFEKTIVITAS EKSTRAK DAUN RAMBUTAN (Nephelium lappaceum L) TERHADAP PERTUMBUHAN JAMUR Candida albicans. Diploma thesis, Poltekkes Kemenkes Tanjungkarang.

ANISA, SALU GANDA PUTRI NUR (2023) GAMBARAN PERENCANAAN MENU DAN PENGADAAN BAHAN MAKANAN DI RUMAH SAKIT BHAYANGKARA BANDAR LAMPUNG TAHUN 2023. Diploma thesis, Poltekkes KemenkesTanjungkarang.

ANISA INDAH SETIA, NINGRUM (2023) ASUHAN KEPERAWATAN KELUARGA DENGAN GANGGUAN OKSIGENASI TERHADAP AN. E PADA KASUS ASMA DI DESA GUNUNG ANGGER KECAMATAN KOTABUMI SELATAN KABUPATEN LAMPUNG UTARA TANGGAL 08-10 NOVEMBER 2022. Diploma thesis, Poltekkes Kemenkes Tanjungkarang.

ANJANI, MUTIARA (2023) ASUHAN KEBIDANAN GIZI KURANG DENGAN PENDAMPINGAN 1000 HARI PERTAMA KEHIDUPAN PADA BADUTA DI TPMB ERNA SETIYAWATI WAY JEPARA LAMPUNG TIMUR. Diploma thesis, Poltekkes Tanjungkarang.

ANJANI, SELLA (2023) ASUHAN KEPERAWATAN DENGAN GANGGUAN SENSORI PERSEPSI HALUSINASI PENDENGARAN PADA KASUS SKIZOFRENIA TERHADAP TN. D DI RUANG NURI RUMAH SAKIT JIWA DAERAH PROVINSI LAMPUNG TANGGAL 01-03 APRIL TAHUN 2022. Diploma thesis, Poltekkes Kemenkes Tanjungkarang.

ANJANI, VANI (2023) ASUHAN KEPERAWATAN PASIEN DENGAN GANGGUAN KEBUTUHAN CAIRAN PADA KASUS DHF TERHADAP AN. SDI RUANG EDELWEIS LANTAI II RSU HANDAYANI KOTABUMI LAMPUNG UTARA TANGGAL 20-25 MARET 2023. Diploma thesis, Poltekkes Kemenkes Tanjungkarang.

ANJUANISA, RETI ANIS (2023) GAMBARAN TINGKAT PENGETAHUAN, PERILAKU HIGIENE PENJAMAH MAKANAN DAN SANITASI LINGKUNGAN KANTIN SD AL-KAUTSAR BANDAR LAMPUNG. Diploma thesis, Poltekkes KemenkesTanjungkarang.

ANNISA, LUTFIYANA FIKRI (2023) FAKTOR-FAKTOR YANG MEMENGARUHI VIRAL LOAD PADA PASIEN HIV DI RSUD Dr. H. ABDUL MOELOEK PROVINSI LAMPUNG TAHUN 2022. Diploma thesis, Poltekkes KemenkesTanjungkarang.

ANNISA, NADYA ULFA (2023) IMPLEMENTASIEDUKASI PADA PASIEN DENGAN MASALAHKEPERAWATAN GANGGUAN CITRA TUBUHPOST OPERASI MASTEKTOMI DI RS BHAYANGKARA POLDA LAMPUNG. Diploma thesis, Poltekkes Kemenkes Tanjungkarang.

ANNISA, QUROTUL (2023) HUBUNGANASUPANB12DANVITAMINCDENGANANEMIAPADAREMAJAPUTRI (Study Literature)TAHUN 2023. Diploma thesis, POLTEKKES KEMENKES TANJUNGKARANG.

ANNISA, SORAYA MEDIA (2023) GAMBARAN STATUS GIZI, PENGETAHUAN GIZI, ASUPANZAT GIZI MAKRO, DAN AKTIVITAS FISIK PADA SISWACALONPOLRIDIBIMBELABDINEGARA BANDARLAMPUNGTAHUN2023. Diploma thesis, POLTEKKES KEMENKES TANJUNGKARANG.

ANTIKA, FUJI (2023) ASUHAN KEPERAWATAN DENGAN GANGGUAN OKSIGENASI PADA KASUS TB PARU TERHADAP NY. K DI RUANGAN FRESIA RUMAH SAKIT UMUM HANDAYANI KOTABUMI LAMPUNG UTARA TANGGAL 10-12 OKTOBER 2022. Diploma thesis, Poltekkes Kemenkes Tanjungkarang.

ANTIKA, HERLIS (2023) ASUHAN KEPERAWATAN GANGGUAN PEMENUHAN KEBUTUHAN NYERI DAN KENYAMANAN (NYERI AKUT) PADA PASIEN POST OP GYNECOMASTIA GRANULOMA DAN POST OP GRANULOMA LIANG TELINGA DI RSUD DR.A.DADI TJOKRODIPO TAHUN 2023. Diploma thesis, Poltekkes KemenkesTanjungkarang.

ANTIKA, MELISA (2023) PENAMBAHAN BUBUK DAUN KELOR DALAM MENU MPASI UNTUK MENINGKATKAN BERAT BADAN BAYI USIA 8 BULAN TERHADAP BY. R DI PMB SITI ROHMAH LAMPUNG SELATAN. Diploma thesis, Poltekkes Tanjungkarang.

ANUGRAH, SHEILLA FITRI (2023) PELAKSANAAN PROGRAM SANITASI TOTAL BERBASIS MASYARAKAT (STBM) PADA PILAR PERTAMA MENUJU DESA ODF DI DESA SINAR MULYA KECAMATAN TANJUNG RAJA TAHUN 2023. Diploma thesis, Poltekkes Kemenkes Tanjung Karang.

APCHATIKA, NA’ILAH GIFIRIA (2023) FAKTOR-FAKTOR YANG BERHUBUNGAN DENGAN PERILAKU PERAWAT DALAM PENERAPAN SURGICAL SAFETY CHECKLIST DI IBS RSUD Dr. H. ABDUL MOELOEK PROVINSI LAMPUNG TAHUN 2023. Diploma thesis, Poltekkes Kemenkes Tanjungkarang.

APRILIA, CHELA (2023) GAMBARAN RASIONALITAS PERESEPAN ANTIBIOTIK PASIEN INFEKSI SALURAN PERNAPASAN AKUT (ISPA) DI PUSKESMAS BUAY NYERUPA SUKAU LAMPUNG BARAT. Diploma thesis, Poltekkes KemenkesTanjungkarang.

APRILIANI, RENI (2023) HUBUNGAN KONDISI LINGKUNGAN FISIK RUMAH DENGAN KEJADIAN ISPA PADA BALITA DI DESA BRANTI RAYA WILAYAH KERJA PUSKESMAS BRANTI RAYA TAHUN 2023. Diploma thesis, Poltekkes Kemenkes Tanjung Karang.

APRILIZA, HAPPY CECE (2023) ASUHAN KEPERAWATAN PASIEN DENGAN GANGGUAN MOBILITAS FISIK PADA KASUS POST SECTIO CAESAREA TERHADAP Ny.V DI RUANG KEBIDANAN RSU HANDAYANI KOTABUMI LAMPUNG UTARA TANGGAL 14 – 16 MARET 2023. Diploma thesis, Poltekkes Kemenkes Tanjungkarang.

APRIYANI, DELA (2023) ASUHAN KEBIDANAN TUMBUH KEMBANG ANAK DENGAN SOSIALISASI DAN KEMANDIRIAN BELUM TERCAPAI MELALUI METODE ROLEPLAY DI TPMB M. EKA RINI SINARSARI KECAMATAN KALIREJO LAMPUNG TENGAH. Diploma thesis, Poltekkes Tanjungkarang.

APRIYANI, LINDA (2023) GAMBARAN FASILITAS SANITASI DI SEKOLAH DASAR KECAMATAN LABUHAN MARINGGAI KABUPATEN LAMPUNG TIMUR TAHUN 2022. Diploma thesis, Poltekkes Tanjungkarang.

APRIYANI, VENY (2023) HUBUNGAN ANTARA INDEKS DMF-T DENGAN KEHILANGAN GIGI PADA LANSIA DI PANTI TRESNA WERDHA NATAR LAMPUNG SELATAN TAHUN 2023. Diploma thesis, Poltekkes Kemenkes Tanjungkarang.

APRIYANTI, APRIYANTI (2023) GAMBARAN FAKTOR-FAKTOR PERILAKU HYGIENE SANITASI MAKANAN DI KANTIN SD KECAMATAN KEDAMAIAN KOTA BANDAR LAMPUNG TAHUN 2023. Diploma thesis, POLTEKKES KEMENKES TANJUNGKARANG.

APRIYANTI, SILVIA (2023) ASUHAN KEPERAWATAN PASIEN DENGAN GANGGUAN OKSIGENASI PADA KASUS TB PARU TERHADAP NY. D DI RUANG PARU RSD MAYJEND HM RYACUDU KOTABUMI LAMPUNG UTARA TANGGAL 19 S.D 21 OKTOBER 2022. Diploma thesis, Poltekkes Kemenkes Tanjungkarang.

APRIYANTO, DONI (2023) ASUHAN KEPERAWATAN POST OPERASI MIOMA UTERIGANGGUAN NYERI AKUT DENGAN INTERVENSITEKNIKRELAKSASINAFAS DALAM DI RSUD Dr. H ABDOEL MOELOEKPROVINSI LAMPUNG TAHUN 2023. Diploma thesis, Poltekkes Kemenkes Tanjungkarang.

ARABEL, DESTIANA (2023) PENERAPAN SENAM NIFAS OTARIA UNTUK MEMPERCEPAT PROSES INVOLUSI UTERUS PADA NY. S DI PMB SITI HAJAR LAMPUNG SELATAN TAHUN 2023. Diploma thesis, Poltekkes Kemenkes Tanjungkarang.

ARDINI, RIDHA SEPTA (2023) HUBUNGAN DUKUNGAN KELUARGA DENGAN KONSEP DIRI PASIEN MASTEKTOMI DI RUANG KEMOTERAPI RSUD JENDRAL AHMAD YANI METRO PROVINSI LAMPUNG TAHUN 2023. Diploma thesis, Poltekkes Kemenkes Tanjungkarang.

ARIFUDIN, IMAM (2023) MOBILISASI DINI PADA PASIENPOST OPERASI OPEN REDUCTION INTERNAL FIXATIONFRAKTUR FEMUR DI RUMAHSAKIT URIPSUMOHARJO LAMPUNG TAHUN 2023. Diploma thesis, Poltekkes Kemenkes Tanjungkarang.

ARINI, AYANG CATUR (2023) PENGARUH PENYULUUHAN MEDIA ANIMASI KARTUN TERHADAP SIKAP ANAK UNTUK MENERIMA PERAWATAN KARIES PADA KELAS III SDN 2 RAJABASA JAYA TAHUN 2023. Diploma thesis, Poltekkes Kemenkes Tanjungkarang.

ARISA, RIRIS (2023) IDENTIFIKASI BAHAN KIMIA OBAT (BKO) PARACETAMOL PADA BEBERAPA SAMPEL JAMU PEGAL LINU YANG DIJUAL DI SALAH SATU MARKETPLACE SHOPEE DENGAN METODE KROMATOGRAFI LAPIS TIPIS. Diploma thesis, Poltekkes KemenkesTanjungkarang.

ARISANDHI, DHIMAS OKTHAVIAN (2023) HUBUNGAN LAMA OPERASI DENGAN KEJADIAN SHIVERING POST OPERASI DI RSUD DR. H. ABDUL MOELOEK PROVINSI LAMPUNG TAHUN 2023. Diploma thesis, Poltekkes KemenkesTanjungkarang.

ARISANDHI, DHIMAS OKTHAVIAN (2023) HUBUNGAN LAMA OPERASI DENGAN KEJADIAN SHIVERING POST OPERASI DI RSUD DR. H. ABDUL MOELOEK PROVINSI LAMPUNG TAHUN 2023. Diploma thesis, Poltekkes KemenkesTanjungkarang.

ARISTANTI, DHILA (2023) EFEKTIFITAS PENYULUHAN MEDIA FLIPCHART DAN BOOKLET TERHADAP TINGKAT KEBERSIHAN GIGI DAN MULUT SISWA/i KELAS IV SDN 1 PURALAKSANA TAHUN 2023. Diploma thesis, Poltekkes Kemenkes Tanjungkarang.

ARIYATI, RARA SUCI (2023) FAKTOR-FAKTOR YANG BERHUBUNGAN DENGAN PELAKSANAAN DISCHARGE PLANNING OLEH PERAWAT PADA PASIEN POST OPERASI DI RSUD Dr. H. ABDUL MOELOEK PROVINSI LAMPUNG TAHUN 2023. Diploma thesis, Poltekkes KemenkesTanjungkarang.

ARMELIA, RISKA INTAN (2023) ASUHAN KEPERAWATAN DENGAN GANGGUAN KEBUTUHAN AKTIVITAS DAN ISTIRAHAT PADA Ny. M DAN Ny.M DENGAN RHEUMATOID ARTHRITIS DI DUSUN SRIMULYO 1 DESA PEMANGGILAN KECAMATAN NATAR KABUPATEN LAMPUNG SELATAN TAHUN 2023. Diploma thesis, Poltekkes KemenkesTanjungkarang.

ARRAHIM, ALWAN RAHMAN ARRAHIM (2023) PERENCANAAN SARANA DESINFEKSI LIMBAH PLASTIK B3 (JERIGEN DIALISAT DAN BOTOL INFUS) UNTUK PROGRAM DAUR ULANG LIMBAH RUMAH SAKIT (STUDI KASUS RSUD dr. H. BOB BAZAR) KALIANDA KABUPATEN LAMPUNG SELATAN TAHUN 2023. Diploma thesis, Poltekkes Kemenkes Tanjung Karang.

ARTIKA, SINDI (2023) PENGARUH KOMBINASI TERAPI KOMPRES HANGAT DENGAN AROMATERAPI JASMINE ESSENSIAL OIL TERHADAPPENURUNAN INTENSITASNYERI PADA PASIEN POST OPERASI LAPARATOMI DI RSUD JEND. A. YANI KOTA METRO TAHUN 2023. Diploma thesis, Poltekkes Kemenkes Tanjungkarang.

ARVIANITA, R. AGFI (2023) HUBUNGAN KONTAK SERUMAH DENGAN PENDERITATUBERKULOSIS PARU DI KELURAHAN PANJANG SELATAN DAN PANJANG UTARA KOTA BANDAR LAMPUNG. Diploma thesis, Poltekkes Kemenkes Tanjungkarang.

ARYA, DENI MAKSUM (2023) ASUHAN KEPERAWATAN GANGGUAN KEBUTUHAN RASA NYAMAN PADA PASIEN CONGESTIVE HEART FAILURE (CHF) DI RUANG TULIP RSUD Dr. H. ABDUL MOELOEK PROVINSI LAMPUNG TAHUN 2023. Diploma thesis, Poltekkes Kemenkes Tanjungkarang.

ARYANI, VIVI (2023) ASUHAN KEBIDANAN NEONATUS DENGAN IKTERUS FISIOLOGIS DI TPMB RATNA WULAN SARI LAMBU KIBANG TULANG BAWANG BARAT. Diploma thesis, Poltekkes Tanjungkarang.

ASHARY, DIVA AMALIA (2023) ANALISIS CEMARAN RESIDU PESTISIDA ORGANOFOSFAT PADA SAYURAN KUBIS (Brassica oleracea) DI PASAR TRADISIONAL KOTA BANDARLAMPUNG. Diploma thesis, Poltekkes Kemenkes Tanjung Karang.

ASHOFAWANDA, DIAN (2023) GAMBARANKEPATUHAN DIET DAN KADAR GULA DARAH PADA ANGGOTA PROLANIS PENDERITA DIABETES MELITUS TIPE 2 DI PUSKESMAS KOTAAGUNG. Diploma thesis, POLTEKKES KEMENKES TANJUNGKARANG.

ASRI, MARISA YUSRO (2023) HUBUNGAN GAYA KEPEMIMPINAN KEPALA RUANG DENGAN PENERAPAN STANDAR RESIKO INFEKSI OLEH PERAWAT DI RUANG RAWAT INAP BEDAH RSUD DR. H. ABDUL MOELOEK PROVINSI LAMPUNG. Diploma thesis, Poltekkes KemenkesTanjungkarang.

ASRIANI, DINDA (2023) MANAJEMEN RISIKO PADA PENGELOLAAN LIMBAH MEDIS BAHAN BERBAHAYA BERACUN (B3) DI RUMAH SAKIT IBU DAN ANAK RESTU BUNDA BANDAR LAMPUNG TAHUN 2023. Diploma thesis, Poltekkes Kemenkes Tanjung Karang.

ASRIYATININGSIH, CATUR (2023) MANAJEMEN RISIKO KESELAMATAN DAN KESEHATAN KERJA (K3) PADA PENGELOLA LIMBAH BAHAN BERBAHAYA DAN BERACUN (B3) DI RUMAH SAKIT AKA MEDIKA SRIBHAWONO KABUPATEN LAMPUNG TIMUR TAHUN 2023. Diploma thesis, Poltekkes Tanjungkarang.

ASSEGHAF, M. IQBAL (2023) HUBUNGAN PENGETAHUAN DAN KETERAMPILAN PERAWAT PERIOPERATIF DENGAN PELAKSANAAN PENDIDIKAN KESEHATAN PADA PROSES DISCHARGE PLANNING DI RSUD Dr. H. ABDUL MOELOEK PROVINSI LAMPUNG TAHUN 2022. Diploma thesis, Poltekkes Kemenkes Tanjungkarang.

ASSEGHAF, M. IQBAL (2023) IMPLEMENTASI TERAPI MUSIK KLASIK PADA PASIEN DENGAN MASALAH KEPERAWATAN NYERI AKUT POST OPERASI HERNIORAPHY DI RUMAH SAKIT MARDI WALUYO METRO TAHUN 2023. Diploma thesis, Poltekkes Kemenkes Tanjungkarang.

ASTRIYANI, DELA (2023) FAKTOR–FAKTOR YANG BERHUBUNGAN DENGAN KEJADIAN DERMATITIS KONTAK PADA PEKERJA BENGKEL MOTOR DI WILAYAH KERJA PUSKESMAS RAWAT INAP GEDONG AIR KOTA BANDAR LAMPUNG TAHUN 2023. Diploma thesis, Poltekkes Kemenkes Tanjung Karang.

ASTUTI, MIRA AYU (2023) GAMBARAN RASIONALITAS PENGGUNAAN OBAT DI DESA PADANG CAHYA KECAMATAN BALIK BUKIT KABUPATEN LAMPUNG BARAT. Diploma thesis, Poltekkes KemenkesTanjungkarang.

ATIKA, GITA (2023) ANALISIS PENGELOLAAN LIMBAH MEDIS PADAT DI RSUD SUKADANA KABUPATEN LAMPUNG TIMUR TAHUN 2022. Diploma thesis, Poltekkes Tanjungkarang.

AULIA, ADE PUTRI (2023) FAKTOR-FAKTOR YANG MEMPENGARUHI KEPATUHAN PERAWAT DALAM MELAKSANAKAN STANDAR PROSEDUR OPRASIONAL PENCEGAHAN RISIKO JATUH PADA PASIEN POST OPERASI DI RSUD DR.H. ABDUL MOELOEK. Diploma thesis, Poltekkes KemenkesTanjungkarang.

AULIA, MUTIARA HUSNUL (2023) GAMBARAN PENYIMPANAN OBAT NARKOTIKA DAN PSIKOTROPIKA DI INSTALASI FARMASI RUMAH SAKIT HANDAYANI KABUPATEN LAMPUNG UTARA PROVINSI LAMPUNG. Diploma thesis, Poltekkes KemenkesTanjungkarang.

AULIARSI, ALIFIA RIZKANUARI (2023) KAJIAN PEMBUATAN SNACKBAR MUESLI DENGAN SUBTITUSI TEPUNG KACANG HIJAU SEBAGAI ALTERNATIF SNACK UNTUK REMAJA PUTRI TAHUN 2023. Diploma thesis, POLTEKKES KEMENKES TANJUNGKARANG.

AULIE, INDRIANS THREE (2023) HUBUNGAN SANITASI KANDANG TERNAK SAPI DENGAN KEJADIAN DIARE DI DESA BUMI DAYA KECAMATAN PALAS KABUPATEN LAMPUNG SELATAN TAHUN 2023. Diploma thesis, Poltekkes Kemenkes Tanjung Karang.

AULYA AMANDA, RATU (2023) GAMBARAN KONDISI RUANG RAWAT INAP RSUD DEMANG SEPULAU RAYA KABUPATEN LAMPUNG TENGAH TAHUN 2023. Diploma thesis, POLTEKKES KEMENKES TANJUNGKARANG.

AURA, WANDA (2023) GAMBARAN KONDISI SANITASI DASAR PADA RUMAH BALITA PENDERITA DIARE DI WILAYAH PUSKESMAS KORPRI BANDAR LAMPUNG TAHUN 2023. Diploma thesis, POLTEKKES KEMENKES TANJUNGKARANG.

AWALIYAH, RAFIQOH (2023) PENATALAKSANAAN ASUHAN GIZI TERSTANDAR PADA PASIEN GAGAL GINJAL KRONIK DENGAN HEMODIALISIS DI RSUD JENDRAL AHMAD YANI METRO. Diploma thesis, POLTEKKES KEMENKES TANJUNGKARANG.

AYU, SITI SANJAYA (2023) PENERAPAN KOMPRES HANGAT TERHADAP PENURUNAN SKALA NYERI PADA PASIEN DISPEPSIA DI RUMAH SAKIT BHAYANGKARA POLDA LAMPUNG PROVINSI LAMPUNG TAHUN 2023. Diploma thesis, Poltekkes KemenkesTanjungkarang.

AYU ROMADHANI, FIRDA (2023) GAMBARAN PENGELOLAAN LIMBAH MEDIS PADAT DI PUSKESMAS GEDONG AIR KECAMATAN TANJUNG KARANG BARAT KOTA BANDAR LAMPUNG TAHUN 2023. Diploma thesis, POLTEKKES KEMENKES TANJUNGKARANG.

AYUNI, DEWI (2023) ASUHAN KEPERAWATAN GAWAT DARURAT DENGAN GANGGUAN OKSIGENASI PADA KASUS STROKE HEMORRHAGE TERHADAP TN. K DI RUANG IGD RUMAH SAKIT UMUM DAERAH AHMAD YANI METRO TANGGAL 10-12 NOVEMBER 2022. Diploma thesis, Poltekkes Kemenkes Tanjungkarang.

AYUNINGTIAS, ERISA (2023) HUBUNGAN EFIKASI DIRI DENGAN TINGKAT KECEMASAN MAHASISWA PRODI SARJANA TERAPAN KEPERAWATAN DALAM MELAKUKAN PRAKTIK KLINIK BEDAH DI RSUD Dr. H. ABDUL MOELOEK PROVINSI LAMPUNG TAHUN 2023. Diploma thesis, Poltekkes Kemenkes Tanjungkarang.

AYUNINGTIAS, FANNY SANIA (2023) PEMANFAATAN LIMBAH CANGKANG KELAPA SAWIT (Elaeis guinennsis jacq) MENJADI ARANG AKTIF TAHUN 2023. Diploma thesis, POLTEKKES KEMENKES TANJUNGKARANG.

AZ ZAHRA, P FADHILLA (2023) ASUHAN KEPERAWATAN JIWA DENGAN KEBUTUHAN PSIKOSOSIAL PADA PASIEN ISOLASI SOSIAL DI RUANG MELATI RUMAH SAKIT JIWA PROVINSI LAMPUNG TAHUN 2023. Diploma thesis, Poltekkes KemenkesTanjungkarang.

AZALIA, IZMI (2023) Gambaran Pola Makan dan Status Gizi Penderita Diabetes Melitus Tipe 2 Prolanis di Puskesmas Ketapang, Sungkai Selatan. Lampung Utara. Diploma thesis, Poltekkes Kemenkes Tanjungkarang.

AZALIA, NESSIE NINA (2023) HUBUNGAN INISIASI MENYUSUI DINI DAN TINGKAT KECEMASAN DENGAN KELANCARAN PRODUKSI ASI PADA IBU POST SECTIO CAESAREA DI RSUD dr. H. BOB BAZAR, SKM TAHUN 2023. Diploma thesis, Poltekkes KemenkesTanjungkarang.

AZHARA, FADILA (2023) ASUPAN PROTEIN DAN ZAT BESI DENGAN KEJADIAN ANEMIA PADA REMAJA PUTRI (STUDI LITERATUR). Diploma thesis, POLTEKKES KEMENKES TANJUNGKARANG.

AZHARI, ANGGUN MARETA (2023) PENATALAKSANAAN ASUHAN GIZI TERSTANDAR PADA PASIEN GAGAL JANTUNG KONGESTIF DENGAN ATRIAL FIBRILASI (AF) DI RS ADVENT BANDAR LAMPUNG TAHUN 2023. Diploma thesis, Poltekkes KemenkesTanjungkarang.

AZHARI, HAFIT (2023) ASUHAN KEPERAWATAN PADA PASIEN POST OP TRANSURETHRAL RESECTION PROSTATE DENGAN INTERVENSI MOBILISASI DINI DI RSUD JENDRAL AHMAD YANI KOTA METRO TAHUN 2023. Diploma thesis, Poltekkes Kemenkes Tanjungkarang.

AZIZAH, YENI NUR JAMIL (2023) PENGARUH TERAPI MUROTTAL AL QUR’AN SURAH MARYAM TERHADAP KECEMASAN PASIEN PRE OPERASI SECTIO CAESAREA DI RSIA ANUGERAH MEDICAL CENTER DI KOTA METRO TAHUN 2023. Diploma thesis, Poltekkes KemenkesTanjungkarang.

AZZAHRA, DEA (2023) GAMBARAN HASIL PEMERIKSAAN TUBEX PADA PENDERITA DEMAM TYPHOID DI RS PERTAMINA BINTANG AMIN PADA TAHUN 2021. Diploma thesis, Poltekkes KemenkesTanjungkarang.

AZZAHRA, FADHILA (2023) FORMULASI DAN EVALUASI SEDIAAN SHAMPO EKSTRAK BUNGA TELANG (Clitoria ternatea L.). Diploma thesis, Poltekkes KemenkesTanjungkarang.

AZZAHRA, SYAHBRINA MIFTHA (2023) Gambaran Faktor Resiko Kejadian Scabies di Pondok Pesantren Yatim Piatu Du’afa Bahrul Ulum Al-Muyassaroh Bandar LampungTahun 2023. Diploma thesis, POLTEKKES KEMENKES TANJUNGKARANG.

Abdullah, Inka Triana (2023) GAMBARAN KONDISI RUMAH PENDERITA TUBERCULOSIS PARU DI WILAYAH KERJA PUSKESMAS SUKARAME KOTA BANDAR LAMPUNG TAHUN 2023. Diploma thesis, POLTEKKES KEMENKES TANJUNGKARANG.

Agustia, Hani (2023) Penerapan Teknik Pelekatan Untuk Keberhasilan Menyusui xvii+62 halaman, 1 tabel, 7 gambar, dan 6 lampiran. Diploma thesis, Poltekkes Tanjungkarang.

Ainy, Syarifah (2023) GAMBARAN PENGETAHUAN MASYARAKAT TENTANG PEMAKAIAN GIGI TIRUAN DI DESA PASURUAN KECAMATAN PENENGAHAN LAMPUNG SELATAN TAHUN 2023. Diploma thesis, Poltekkes Kemenkes Tanjungkarang.

Akbar, Nadia Febriantika Putri (2023) GAMBARAN PENILAIAN SISWA SISWI KELAS 10 DAN KELAS 11 TERHADAP MAKANAN DI ASRAMA MAN 1 BANDAR LAMPUNG TAHUN 2023. Diploma thesis, POLTEKKES KEMENKES TANJUNGKARANG.

Alfain, Fajar (2023) DAMPAK KUALITAS PENCAHAYAAN TERHADAP MASALAH KESEHATAN DI LABORATORIUM PENDIDIKAN POLITEKNIK KESEHATAN TANJUNG KARANG TAHUN 2023. Diploma thesis, Poltekkes KemenkesTanjungkarang.

Alfariz, Ilham Riyadh (2023) PEMBUATAN GIGI TIRUAN SEBAGIAN LEPASAN PARADENTAL KOMBINASI AKRILIK DENAN TERMOPLASTIK AKRILIK RAHANG ATAS DAN AKILIK RAHANG BAWAH PADA KASUS MESIOVERSI 37 DAN 47. Diploma thesis, Poltekkes KemenkesTanjungkarang.

Alifiya, Fani Haya (2023) GAMBARAN PENGETAHUAN MAHASISWA TINGKAT 1 JURUSAN TEKNIK GIGI TAHUN AKADEMIK 2022/2023 TENTANG MANIPULASI BAHAN CETAK ALGINAT. Diploma thesis, Poltekkes KemenkesTanjungkarang.

Alizah, Asyifa Nur (2023) GAMBARAN KEPADATAN JENTIK NYAMUK AEDES AEGYPTI DI WILAYAH KERJA PUSKESMAS RAWAT INAP WAY KANDIS KELURAHAN TANJUNG SENANG BANDAR LAMPUNG 2023. Diploma thesis, POLTEKKES KEMENKES TANJUNGKARANG.

Amanda, Tiara (2023) PEMBUATAN GIGI TIRUAN SEBAGIAN LEPASAN AKRILIK UNILATERAL FREE END RAHANG ATAS DAN RAHANG BAWAH DENGAN KASUS EKSTRUSI GIGI 17. Diploma thesis, Poltekkes KemenkesTanjungkarang.

Amelia, Dhea (2023) PENATALAKSANAAN ASUHAN GIZI TERSTANDAR PADA PASIEN PENDERITA GASTRITIS DI RSUD TUBABA KABUPATEN TULANG BAWANG BARAT TAHUN 2023. Diploma thesis, POLTEKKES KEMENKES TANJUNGKARANG.

Arsita Putri, Mesi (2023) PENATALAKSANAAN LUKA PERINEUM PADA IBU POSTPARTUM DENGAN PEMBERIAN JUS NANAS TERHADAP NY.I DI PMB DWI LESTARI,A.Md.Keb LAMPUNG SELATAN. Diploma thesis, Poltekkes Tanjungkarang.

Asih, Luti Karpinang (2023) GAMBARAN KEPATUHAN MAHASISWA TERHADAP PENGGUNAAN HANDSCOON PADA PROSEDUR PEMBUATAN GIGI TIRUAN DI LABORATORIUM TEKNIK GIGI POLITEKNIK KESEHATAN TANJUNG KARANG. Diploma thesis, Poltekkes KemenkesTanjungkarang.

Astuti, Adinda Dwi (2023) PEMBUATAN GIGI TIRUAN SEBAGIAN LEPASAN AKRILIK RAHANG ATAS DAN RAHANG BAWAH KLASIFIKASI KENNEDY KELAS III MODIFIKASI 1 PADA KASUS CROSSBITE ANTERIOR. Diploma thesis, Poltekkes KemenkesTanjungkarang.

Aulia Tasya Defria, Izzati (2023) PENGARUH PEMBERIAN AROMATERAPI LAVENDER DALAM MENGURANGI MUAL MUNTAH PADA IBU HAMIL 9 MINGGU TRIMESTER 1 PADA NY. R DI PMB RAHAYU. Diploma thesis, Poltekkes Tanjungkarang.

Aulya, Shanin Dita Nurul (2023) PENATALAKSANAANASUHAN GIZI TERSTANDAR PADA REMAJA OBESITAS DI SMA AL-AZHAR 3 PROVINSI LAMPUNG TAHUN 2023. Diploma thesis, POLTEKES KEMENKES TANJUNGKARANG.

Azis, Melati Angelita (2023) PENATALAKSANAAN PENINGKATAN PENGELUARAN ASI PADA IBU NIFAS DENGAN KONSUMSI SARI KURMA DAN PIJAT OKSITOSIN. Diploma thesis, Poltekkes Tanjungkarang.

B

BAHTIAR, FAJRI (2023) ASUHAN KEPERAWATAN PASIEN DENGAN GANGGUAN OKSIGENASI PADA KASUS ASMA BRONKIAL TERHADAP NY. S DI RUANG PARU RSD MAYJEND HM RYACUDU KOTABUMI LAMPUNG UTARA TANGGAL 10-13 OKTOBER 2022. Diploma thesis, Poltekkes Kemenkes Tanjungkarang.

BALQIS.MS 2013451035, ADHLIA SALSABILA (2023) GAMBARAN PENGELOLAAN SAMPAH DI TEMPAT PEMBUANGAN AKHIR SAMPAH (TPAS) KARANGREJO KOTA METRO TAHUN 2023. Diploma thesis, POLTEKKES KEMENKES TANJUNGKARANG.

BAROKA, IMA UZNI (2023) MANAJEMEN RISIKO KESELAMATAN DAN KESEHATAN KERJA (K3) DALAM PENGELOLAAN SEMEN PADA TAHAP PACKING PLANT DI PT SEMEN BATURAJA (PERSERO) TBK TAHUN 2023. Diploma thesis, Poltekkes Tanjungkarang.

BAROKAH, UMI (2023) HUBUNGAN HIGIENE PERORANGAN DAN SANITASI LINGKUNGAN DENGAN KEJADIAN SCABIES DI PONDOK PESANTREN AL-FATTAH LAMPUNG SELATAN TAHUN 202. Diploma thesis, Poltekkes Tanjungkarang.

BATARA, AGIL CAHYA (2023) HUBUNGAN JOB PERFORMANCE DAN WORK ENGAGEMENT DENGAN MANAJEMEN ENERGI PERAWAT DI RSUD DR. H. ABDUL MOELOEK PROVINSI LAMPUNG. Diploma thesis, Poltekkes KemenkesTanjungkarang.

BATARA, AGIL CAHYA (2023) HUBUNGAN JOB PERFORMANCE DAN WORK ENGAGEMENT DENGAN MANAJEMEN ENERGI PERAWAT DI RSUD DR. H. ABDUL MOELOEK PROVINSI LAMPUNG. Diploma thesis, Poltekkes KemenkesTanjungkarang.

BELIA, FRISKA DINDA (2023) GAMBARAN KADAR ASAM URAT PADA PASIEN ARTRITIS GOUT DI RS ADVENT BANDAR LAMPUNG TAHUN 2022. Diploma thesis, Poltekkes KemenkesTanjungkarang.

BELIUK, NADIA (2023) ASUHAN KEPERAWATAN GERONTIK TERHADAP TN. N DENGAN GANGGUAN RASA AMAN NYAMAN PADA KASUS HIPERTENSI DI DESA BANDAR PUTIH WILAYAH KERJA PUSKESMAS KOTABUMI II, KABUPATEN LAMPUNG UTARA TANGGAL 15- 17 NOVEMBER 2022. Diploma thesis, Poltekkes Kemenkes Tanjungkarang.

BERUTU, INDAH WULANDARI (2023) IMPLEMENTASI TEKNIK RELAKSASI AUTOGENIK PADA PASIEN DENGAN NYERI POST OPERASI OPEN PROSTATECTOMY DI RUANG ANGGREK DI RS MARDI WALUYO. Diploma thesis, Poltekkes Kemenkes Tanjungkarang.

BILQIS, SANA LATIFAH RAMADHANI (2023) GAMBARAN PROFIL HEMATOLOGI RUTIN PADA PASIEN DEMAM BERDARAH DENGUE ANAK DI RSUD Dr. A. DADI TJOKRODIPO KOTA BANDAR LAMPUNG. Diploma thesis, Poltekkes KemenkesTanjungkarang.

BRAMITA, YOSICA (2023) IMPLEMENTASI TEKNIK RELAKSASI BENSON PADA ASUHAN KEPERAWATAN NYERI PASIEN POST MASTEKTOMIDI RSUD DR. H ABDUL MOELOEK PROVINSI LAMPUNG TAHUN 2023. Diploma thesis, Poltekkes Kemenkes Tanjungkarang.

BUDIARJO, FRIDA MAULANI (2023) HUBUNGAN KONDISI LINGKUNGAN FISIK RUMAH DAN PERILAKU MASYARAKAT DENGAN PREVALENSI TUBERKULOSIS PARU DI WILAYAH KERJA PUSKESMAS RAWAT INAP SATELIT KOTA BANDAR LAMPUNG TAHUN 2023. Diploma thesis, Poltekkes Kemenkes Tanjung Karang.

BUDIMAN, RADEN (2023) ASUHAN KEPERAWATAN GANGGUAN KEBUTUHAN OKSIGENASI PADA PASIEN BRONKOPNEUMONIA DI RUANG ALAMANDA RSUD DR. H. ABDUL MOELOEK PROVINSI LAMPUNG TAHUN 2023. Diploma thesis, Poltekkes KemenkesTanjungkarang.

Baini, Arinda (2023) ASUHAN KEPERAWATAN KELUARGA DENGAN GANGGUAN RASA NYAMAN PADA KASUS GASTRITIS TERHADAP INDIVIDU NY. I DI WILAYAH KERJA PUSKESMAS KOTABUMI II LAMPUNG UTARA TANGGAL 31 OKTOBER - 4 NOVEMBER 2022. Diploma thesis, Poltekkes Kemenkes Tanjungkarang.

Bestari, Dinda Ayu (2023) GAMBARAN STATUS GIZI, STATUS PERTUMBUHAN, DAN TEKNIK MENYUSUI DALAM PRAKTIK PEMBERIAN ASI DI DESA FAJAR BULAN KECAMATAN WAY TENONG KABUPATEN LAMPUNG BARAT. Diploma thesis, Poltekkes Kemenkes Tanjungkarang.

C

CAHYA, FARIDA INDAH (2023) GAMBARAN PENGETAHUAN ASUPAN KALIUM DAN NATRIUM PADA PENDERITA HIPERTENSI DIPROLANIS PUSKESMAS WAY KANDIS KOTA BANDAR LAMPUNG. Diploma thesis, POLTEKKES KEMENKES TANJUNGKARANG.

CAHYADO, IMRON (2023) GAMBARAN PENGELOLAAN SAMPAH DI OBJEK WISATA PANTAI LABUHAN JUKUNG KABUPATEN PESISIR BARAT LAMPUNG TAHUN 2023. Diploma thesis, POLTEKKES KEMENKES TANJUNGKARANG.

CAHYANI, ALIKA RIZKY (2023) GAMBARAN PENDERITA MALARIA DI UPT PUSKESMAS MAJA KECAMATAN MARGA PUNDUH KABUPATEN PESAWARAN TAHUN 2021-2022. Diploma thesis, Poltekkes KemenkesTanjungkarang.

CAHYANI, ANNISA REGITA (2023) ASUHAN KEPERAWATAN DENGAN GANGGUAN PEMENUHAN KEBUTUHAN RASA NYAMAN PADA PASIEN HIPERTENSI DI DESA SRIMULYO PEMANGGILAN NATAR LAMPUNG SELATAN TAHUN 2023. Diploma thesis, Poltekkes KemenkesTanjungkarang.

CAHYANI, DEWI (2023) ASUHAN KEPERAWATAN GANGGUAN KEBUTUHAN NYERI DAN KENYAMANAN PADA PASIEN DENGAN POST OPERASI TONSILEKTOMI DI RUMAH SAKIT TK IV 02.07.04 DENKESYAH 02.04.03 LAMPUNG TAHUN 2023. Diploma thesis, Poltekkes KemenkesTanjungkarang.

CAHYANI, LINTANG INDAH (2023) ASUHAN KEPERAWATAN GANGGUAN NYERI AKUT PADA PASIEN LIMFOMA MALIGNA DI RUANG PENYAKIT DALAM NON INFEKSIUS RSUD Dr. H. ABDUL MOELOEK PROVINSI LAMPUNG TAHUN 2023. Diploma thesis, Poltekkes KemenkesTanjungkarang.

CAHYANI, PUTRI REGITA (2023) ASUHAN KEPERAWATAN GANGGUAN KEBUTUHAN OKSIGENASI PADA PASIEN PENYAKIT PARU OBSTRUKSI KRONIK (PPOK) DI RUANG PARU RSUD DR. A. DADI TJOKRODIPO LAMPUNG TAHUN 2023. Diploma thesis, Poltekkes KemenkesTanjungkarang.

CAHYANI, RIZKI PUTRI (2023) GAMBARAN HYGIENE SANITASI MAKANAN DI KANTIN SEKOLAH DASAR KECAMATAN TEGINENENG KABUPATEN PESAWARAN TAHUN 2023. Diploma thesis, POLTEKKES KEMENKES TANJUNGKARANG.

CAHYANI, VINTA EVRILYA PUTRI (2023) ASUHAN KEBIDANAN PADA IBU HAMIL DENGAN ANEMIA RINGAN DI TEMPAT PRAKTIK MANDIRI BIDAN ARYATI SUMARLINDA MARGA ASRI TULANG BAWANG BARAT. Diploma thesis, Poltekkes Tanjungkarang.

CAHYANI, WAHYU (2023) PENERAPAN KOMPRES DAUN DADAP PADA BAYI DEMAM DI PMB WAWAT MIKE A.Md.Keb LAMPUNG SELATAN. Diploma thesis, Poltekkes Tanjungkarang.

CAHYANINGTIYAS, YOSI (2023) IMPLEMENTASI TEKNIK RELAKSASI GENGGAM JARI DALAM MENGATASI NYERI AKUT PADA PASIEN POSTDEBRIDEMENT ULKUS DIABETIKUM DI RSUD JENDRAL AHMAD YANI KOTA METRO. Diploma thesis, Poltekkes Kemenkes Tanjungkarang.

CAHYANTI, DILA PUTRI (2023) PENGARUH MENGUNYAH PERMEN KARET MENGANDUNG XYLITOL DAN MOBILISASI DINI TERHADAP TIMBULNYA FLATULENSI POST OPERASI DENGAN GENERAL ANESTESI DI RSUD Dr. H. ABDUL MOELOEK PROVINSI LAMPUNG TAHUN 2023. Diploma thesis, Poltekkes KemenkesTanjungkarang.

CESARIA, FEBRI ANI (2023) FAKTOR – FAKTOR YANG BERHUBUNGAN DENGAN PELAKSANAAN MOBILISASI DINI PADA PASIEN POST OPERASI FRAKTUR FEMUR DI RSUD Dr. H. ABDUL MOELOEK PROVINSI LAMPUNG TAHUN 2023. Diploma thesis, Poltekkes KemenkesTanjungkarang.

CHAFIFAH, LISTIANI NUR (2023) ASUHAN KEPERAWATAN PASIEN POST URETEROSCOPIC LITHOTRIPSY (URS) DENGAN MASALAH KEPERAWATAN NAUSEA (PONV)MELALUI INTERVENSI MOBILISASI DINI DI RSUD JENDERAL AHMAD YANI KOTA METRO TAHUN 2023. Diploma thesis, Poltekkes Kemenkes Tanjungkarang.

CHAIRUNISYA, LAILUL (2023) GAMBARAN PENGETAHUAN KOMUNIKASI TERAPEUTIK MAHASISWA/I TINGKAT II JURUSAN KESEHATAN GIGI POLTEKKES TANJUNGKARANG TAHUN 2023. Diploma thesis, Poltekkes Kemenkes Tanjungkarang.

CHAIRUNNISA, ASA DILLA (2023) FORMULASI DAN EVALUASI SEDIAAN DEODORANT SPRAY MINYAK ATSIRI DAUN KEMANGI (Ocimum basilicum L.) DAN DAUN MINT (Mentha piperita L.). Diploma thesis, Poltekkes KemenkesTanjungkarang.

CHANIAGO, ABUZAR ALQHIFARI (2023) GAMBARAN PENDERITA MALARIA DI PUSKEMAS MAJA KECAMATAN MARGA PUNDUH KABUPATEN PESAWARAN PADA TAHUN 2019 - 2020. Diploma thesis, Poltekkes KemenkesTanjungkarang.

CHOIRUNNISA, AULIA (2023) GAMBARAN PENGETAHUAN, SIKAP, DAN PRAKTIK GIZI SEIMBANG PADA REMAJA PUTRI DI ASRAMA MAHASISWA BAITUSSHODIQ RAJABASA BANDAR LAMPUNG TAHUN 2023. Diploma thesis, Poltekkes Kemenkes Tanjungkarang.

CHUZAIFA, VIOLA (2023) PENGARUH EKSTRAK DAUN SIRIH MERAH (Piper crocatum) TERHADAP KUTU KEPALA (Pediculus humanuscapitis). Diploma thesis, Poltekkes Kemenkes Tanjungkarang.

CORNEVA, FIDYA (2023) PENGARUHBERKUMURAIRREBUSANJAHEMERAH TERHADAPPENURUNAN INDEKS PLAKPADAKELOMPOKWANITA TANIKAMPUNGAGROWIDYAWISATA. Diploma thesis, Poltekkes Kemenkes Tanjungkarang.

CRISTHY SAMIRIN, EVA (2023) ASUHAN KEBIDANAN PADA IBU NIFAS DENGAN PENDAMPINGAN MENYUSUI DALAM RANGKA PENCEGAHAN BENDUNGAN ASI DI TEMPAT PRAKTIKMANDIRI BIDAN MARGA KENCANA TULANG BAWANG BARAT. Diploma thesis, Poltekkes Tanjungkarang.

Casebella, Jihan Clearesta (2023) Penatalaksanaan Manajemen Laktasi Posisi Menyusui Cross Cradle untuk Meningkatkan Pengetahuan Ibu Nifas pada Ny. R di PMB Siti Jamila, S.ST Lampung Selatan. Diploma thesis, Poltekkes Tanjungkarang.

Choirina, Syifa (2023) PEMBUATAN GIGI TIRUAN SEBAGIAN LEPASAN AKRILIK KEHILANGAN GIGI 26, 27,36, 37, 46 DENGAN KASUS MESIOVERSI PADA GIGI 28 DAN 38. Diploma thesis, Poltekkes KemenkesTanjungkarang.

D

DAHNIAR, HERNI (2023) GAMBARAN PELAKSANAAN 5 PILAR SANITASI TOTAL BERBASIS MASYARAKAT (STBM) DI WILAYAH KERJA PUSKESMAS KALIREJO DESA SRIBASUKI KECAMATAN KALIREJO KABUPATEN LAMPUNG TENGAH TAHUN 2023. Diploma thesis, POLTEKKES KEMENKES TANJUNGKARANG.

DAMAIYANTI, RIZKA (2023) GAMBARAN SANITASI DASAR DI DESA ROWOREJO KECAMATAN NEGERI KATON KABUPATEN PESAWARAN TAHUN 202. Diploma thesis, POLTEKKES KEMENKES TANJUNGKARANG.

DAMAYANTI, PUTRI ANGELINA (2023) ASUHAN KEPERAWATAN PASIEN DENGAN MASALAH GANGGUAN PERSEPSI SENSORI : HALUSINASI PENDENGARAN PADA KASUS SKIZOFRENIA TERHADAP Ny.R DI RUANG MELATIRUMAH SAKIT JIWADAERAH PROVINSI LAMPUNG TANGGAL 14-16 MARET 2022. Diploma thesis, Poltekkes Kemenkes Tanjungkarang.

DAMERIA, DAMERIA (2023) ASUHAN KEPERAWATAN NYERI AKUT DENGAN PENERAPAN RELAKSASI GENGGAM JARI PADA PASIEN POST OPERASI HERNIOTOMY DI RUMAH SAKIT BHAYANGKARA BANDAR LAMPUNG. Diploma thesis, Poltekkes Kemenkes Tanjungkarang.

DANI, FILDA SARI (2023) PERBANDINGAN HASIL KUALITAS PEWARNAAN HEMATOXYLIN-EOSIN BARU DAN LAMA PADA PREPARAT HISTOPATOLOGI KANKER PAYUDARA DI KLINIK MOROTAI PATOLOGI KOTA BANDAR LAMPUNG. Diploma thesis, Poltekkes Kemenkes Tanjungkarang.

DARMAWAN, FAJRI (2023) GAMBARAN KECELAKAAN KERJA PADA PEKERJA BAGIAN PRODUKSI DI PT. SICINI INTERNUSA KABUPATEN LAMPUNG TIMUR TAHUN 2023. Diploma thesis, POLTEKKES KEMENKES TANJUNGKARANG.

DAU, DEDI SAPUTRA (2023) GAMBARAN PENGETAHUAN DAN PERILAKU MASYARAKAT DALAM PENGELOLAAN SAMPAH RUMAH TANGGA DI RT 001 LINGKUNGAN 1 KELURAHAN GUNUNG AGUNG KECAMATAN LANGKAPURA KOTA BANDAR LAMPUNG TAHUN 2023. Diploma thesis, POLTEKKES KEMENKES TANJUNGKARANG.

DEHTO, MUHAMMAD KAMIL (2023) GAMBARAN NILAI PARAMETER LIMBAH CAIR CUCIAN NANAS PT GREAT GIANT PINEAPPLE PG4 LAMPUNG TIMUR SEBAGAI PENENTU TINGKAT EFEKTIVITAS PENGOLAHAN LIMBAH CAIR TAHUN 2022. Diploma thesis, Poltekkes Tanjungkarang.

DELA, GINA SOFIA (2023) GAMBARAN PENGGUNAAN TANAMAN OBAT PASCA MELAHIRKAN PADA IBU DAN BAYI DI KECAMATAN SUKAU KABUPATEN LAMPUNG BARAT TAHUN 2023. Diploma thesis, Poltekkes KemenkesTanjungkarang.

DENAD, SALSABILA BINTANG (2023) GAMBARAN KEPADATAN JENTIK NYAMUK AEDES AEGYPTI BERDASARKAN INDIKATOR HOUSE INDEX (HI) DAN ANGKA BEBAS JENTIK (ABJ) DI WILAYAH KERJA PUSKESMAS KOTABUMI II KABUPATEN LAMPUNG UTARA TAHUN 2023. Diploma thesis, POLTEKKES KEMENKES TANJUNGKARANG.

DENDITA, DENDITA (2023) GAMBARAN KONDISI HIGINE SANITASI PADA DEPOT AIR MINUM ISI ULANG DI WILAYAH KERJA PUSKESMAS KUPANG KOTA TAHUN 2023. Diploma thesis, POLTEKKES KEMENKES TANJUNGKARANG.

DESTARI, FATIKA (2023) ASUHAN KEBIDANAN KEHAMILAN DENGAN EDEMA EKSTREMITAS DI TEMPAT PRAKTIK MANDIRI BIDAN UMI KHOIRIYAH SIDOREJO KABUPATEN LAMPUNG TENGAH. Diploma thesis, Poltekkes Tanjungkarang.

DESTHALIA, ERSA (2023) KUALITAS PEWARNAAN PADA SEDIAAN SITOLOGI PENDERITA TUBERKULOSIS KELENJAR DI KLINIK MOROTAI PATOLOGI KOTA BANDAR LAMPUNG TAHUN 2021. Diploma thesis, Poltekkes KemenkesTanjungkarang.

DESTIANA, ELLA (2023) ASUHAN KEBIDANAN PADA ANAK BALITA DENGAN PERKEMBANGAN MERAGUKAN MOTORIK HALUS DI TEMPAT PRAKTIK MANDIRI BIDAN APRIYANTI WAY JEPARA LAMPUNG TIMUR. Diploma thesis, Poltekkes Tanjungkarang.

DESTIANI, KIKI (2023) GAMBARAN FAKTOR KEJADIAN SCABIES PADA SANTRI DAN SANTRIWATI DI PONDOK PESANTREN DARUL A’MAL KOTA METRO. Diploma thesis, POLTEKKES KEMENKES TANJUNGKARANG.

DESWITA, SAFIRA (2023) HUBUNGAN PERAN IBU DALAM PEMBERIAN SUSUBOTOLTERHADAPTERJADINYA RAMPAN KARIES PADA ANAK PRASEKOLAH DI TK- AL HAIRIAH BANDARLAMPUNG TAHUN2023. Diploma thesis, Poltekkes Kemenkes Tanjungkarang.

DEVITA, HERLYANA (2023) UJI EKSTRAK DAN SERBUK DAUN SALAM (Syzygium polyanthum) DALAM MEMBUNUH LARVA NYAMUK Aedes aegypti INSTAR II. Diploma thesis, POLTEKKES KEMENKES TANJUNGKARANG.

DEVIYANTI, SERLY (2023) ASUHAN KEBIDANAN EMESIS GRAVIDARUM DENGAN PENDAMPINGAN 1000 HARI PERTAMA KEHIDUPAN PADA IBU HAMIL DI TPMB SITI WASIRAH KIBANG BUDI JAYA TULANG BAWANG BARAT. Diploma thesis, Poltekkes Tanjungkarang.

DEWANTY, BELIA RAHMA (2023) MANAJEMEN RISIKO KESELAMATAN DAN KESEHATAN KERJA (K3) PADA PEKERJA DI AREA APRON BANDAR UDARA RADIN INTEN II LAMPUNG TAHUN 2023. Diploma thesis, Poltekkes Kemenkes Tanjung Karang.

DEWI, AJENG KUMALA (2023) GAMBARAN PEMANFAATAN TANAMAN OBAT SEBAGAI TERAPI ALTERNATIF PADA MASYARAKAT DESA PURWODADI KECAMATAN BANGUNREJO KABUPATEN LAMPUNG TENGAH. Diploma thesis, Poltekkes KemenkesTanjungkarang.

DEWI, CHINDY HERLIANA (2023) GAMBARAN PENGETAHUAN, SIKAP, PERILAKU, HYGIENE DAN SANITASI PENGOLAHAN MAKANAN DI PONDOK PESANTRENAL HIKMAH BANDAR LAMPUNG. Diploma thesis, POLTEKKES KEMENKES TANJUNGKARANG.

DEWI, DESAK NYOMAN INDRA (2023) STUDI KASUS PADA IBU PASCA SEKSIO SESAREA DENGAN MASALAH MENYUSUI TIDAK EFEKTIF DI RUMAH SAKIT BHAYANGKARA. Diploma thesis, Poltekkes Kemenkes Tanjungkarang.

DEWI, ERMALA (2023) PENGARUH KADAR FORMALIN PADA IKAN TERI JENGKI DENGAN PERENDAMAN AIR GARAMDAN AIR CUCIAN BERAS. Diploma thesis, Poltekkes Kemenkes Tanjungkarang.

DEWI, FEBRIANI PERMATA (2023) ASUHAN KEBIDANAN PADA BALITA DENGAN PERKEMBANGAN MOTORIK HALUS MERAGUKAN DI TEMPAT PRAKTIK MANDIRI BIDAN DIANA MUNZIR WAY JEPARA LAMPUNG TIMUR. Diploma thesis, Poltekkes Tanjungkarang.

DEWI, FEBY ATIKA (2023) GAMBARAN PENGETAHUAN, SIKAP DAN KETERAMPILAN KADER POSYANDU DALAM PEMANTAUAN PERTUMBUHAN BALITA DI WILAYAH KERJA PUSKESMAS WAY MILI KECAMATAN GUNUNG PELINDUNG KABUPATEN LAMPUNG TIMUR PROVINSI LAMPUNG. Diploma thesis, Poltekkes Kemenkes Tanjungkarang.

DEWI, MARISA RUSLIANA (2023) ASUHAN KEBIDANAN PADA IBU HAMIL DENGAN ANEMIA RINGAN DI TEMPAT PRAKTIK MANDIRI BIDAN RATNA WULAN SARI TULANG BAWANG BARAT. Diploma thesis, Poltekkes Tanjungkarang.

DEWI, NI KETUT RATNA (2023) ASUHAN KEPERAWATAN GANGGUAN INTEGRITAS JARINGAN DENGAN PEMBERIAN POLYHEXAMETHYLENE DAN MADU PADA PASIEN POST DEBRIDEMENT ULKUS DIABETIKUM DI RUMAH SAKIT MARDI WALUYO PADA TAHUN 2023. Diploma thesis, Poltekkes Kemenkes Tanjungkarang.

DEWI, SUCI ROSMALA (2023) APLIKASI GERABAH TANAH LIAT (OVITRAP) SEBAGAI UPAYA PENGENDALIAN JENTIK NYAMUK TAHUN 2023. Diploma thesis, POLTEKKES KEMENKES TANJUNGKARANG.

DIANA, MERALEY (2023) ASUHAN KEPERAWATAN GANGGUAN PEMENUHAN KEBUTUHAN ISTIRAHAT DAN TIDUR PADA PASIEN HIPERTENSI DI DUSUN SRIMULYO 1 DESA PEMANGGILAN KECAMATAN NATAR LAMPUNG SELATAN TAHUN 2023. Diploma thesis, Poltekkes KemenkesTanjungkarang.

DIANA, PUTRI ALSYIRA (2023) GAMBARAN KEJADIAN DEMAM THYPOID DI WILAYAH KERJA PUSKESMAS RAWAT INAP WAY KANDIS KOTA BANDAR LAMPUNG TAHUN 2022. Diploma thesis, POLTEKKES KEMENKES TANJUNGKARANG.

DIANI, SERLI (2023) PENGARUH TERAPI RELAKSASI OTOT PROGRESIF TERHADAP TINGKAT KECEMASAN PASIEN PRE OPERASI DI RSUD Dr. H. ABDUL MOELOEK PROVINSI LAMPUNG TAHUN 2023. Diploma thesis, Poltekkes KemenkesTanjungkarang.

DIANSYAH, ROBY (2023) ASUHAN KEPERAWATAN GANGGUAN PEMENUHAN KEBUTUHAN RASA AMAN NYAMAN TERHADAP NY.S DAN TN.T PADA PASIEN HIPERTENSI DI DESA PEMANGGILAN NATAR LAMPUNG SELATAN TAHUN 2023. Diploma thesis, Poltekkes KemenkesTanjungkarang.

DIENTAMA, RIFAL (2023) GAMBARAN FASILITAS SANITASI DASAR DI SEKOLAH DASAR KECAMATAN BATU BRAK KABUPATEN LAMPUNG BARAT TAHUN 2023. Diploma thesis, POLTEKKES KEMENKES TANJUNGKARANG.

DILLA, CHODIZA NASYAHTA (2023) ASUHAN KEPERAWATAN GERONTIK DENGAN GANGGUAN KEBUTUHAN RASA NYAMAN PADA KASUS GOUT ARTHRITIS TERHADAP Ny. F DI DESA KOTA ALAM WILAYAH KERJA PUSKESMAS KOTABUMI II KABUPATEN LAMPUNG UTARA TANGGAL 24-26 OKTOBER 2022. Diploma thesis, Poltekkes Kemenkes Tanjungkarang.

DILLA, YANI NIKA (2023) GAMBARAN KONSTRUKSI DAN KUALITAS AIR BERSIH SARANA SUMUR GALI PADA PENDERITA DIARE DI DUSUN SEBALANG 1 KECAMATAN KATIBUNG KABUPATEN LAMPUNG SELATAN TAHUN 2023. Diploma thesis, POLTEKKES KEMENKES TANJUNGKARANG.

DINASAKTI, ELISA (2023) ASUHAN KEPERAWATAN DENGAN GANGGUAN KEAMANAN DAN PROTEKSI PADA KASUS ULKUS DIABETIKUM TERHADAP NY. C DI RUANG BEDAH RSUD MAYJEND HM RYACUDU KOTABUMI LAMPUNG UTARA TANGGAL 25-27 OKTOBER 2022. Diploma thesis, Poltekkes Kemenkes Tanjungkarang.

DINATA, NOVREZA (2023) HUBUNGAN KADAR KOLESTEROL TOTAL DENGAN KADAR HBA1C PADAPENDERITA DIABETES MELITUSTIPE 2 DI LABORATORIUMKLINIKPRAMITRABIOLAB INDONESIA. Diploma thesis, Poltekkes Kemenkes Tanjungkarang.

DINELSA, MARETHA MIRANDHA (2023) EFEKTIVITAS BERKUMUR MENGGUNAKAN LARUTAN MADU TERHADAP PENURUNAN INDEKS PLAK PADA SISWA/I KELAS III-IV SDN 5 TANJUNG HARAPAN TAHUN 2023. Diploma thesis, Poltekkes Kemenkes Tanjungkarang.

DIVA ANGGITA, FAZRILA (2023) GAMBARAN PENGETAHUAN DAN SIKAP PESERTA PROGRAM PENGELOLAAN PENYAKIT KRONIS (PROLANIS) TERKAIT PENGENDALIAN HIPERTENSI MELALUI GIZI SEIMBANG DI PUSKESMAS WAY KANDIS KOTA BANDAR LAMPUNG TAHUN 2023. Diploma thesis, Poltekkes KemenkesTanjungkarang.

DOKTALIA, PUTRI (2023) ASUHAN KEPERAWATAN GERONTIK DENGAN GANGGUAN RASA AMAN NYAMAN PADA KASUS GASTRITIS TERHADAP TN. D DI DESA TANJUNG AMAN KABUPATEN LAMPUNG UTARA WILAYAH KERJA PUSKESMAS KOTABUMI II TANGGAL 14-16 MARET 2023. Diploma thesis, Poltekkes Kemenkes Tanjungkarang.

DOMAS, EBTIO YEZAKI (2023) ASUHAN KEPERAWATAN GANGGUAN KEBUTUHAN OKSIGENASI PADA KASUS ASMA BRONKIAL TERHADAP TN A DI RUANG INSTALASI GAWAT DARURAT RSUD JENDRAL AHMAD YANI METRO LAMPUNG 18 NOVEMBER 2022. Diploma thesis, Poltekkes Kemenkes Tanjungkarang.

DOMAS, TITANIA PRATIWI (2023) GAMBARAN PENGOLAHAN AIR MINUM IPA 1 DI PERUSAHAAN UMUM DAERAH (PERUMDA) AIR MINUM WAY RILAU BANDAR LAMPUNG TAHUN 2023. Diploma thesis, POLTEKKES KEMENKES TANJUNGKARANG.

DWI FITRIA, NI MADE (2023) GAMBARAN PENGELOLAAN LIMBAH MEDIS PADAT DI RUMAH SAKIT UMUM DAERAH SUKADANA KABUPATEN LAMPUNG TIMUR TAHUN 2023. Diploma thesis, POLTEKKES KEMENKES TANJUNGKARANG.

DZAHABIYYAH, SYIFA YOLANDA (2023) GAMBARAN KADAR HbA1c PADA PASIEN PENDERITA DIABETES MELLITUS TIPE 2 DI RUMAH SAKIT ADVENT BANDAR LAMPUNG TAHUN 2021-2022. Diploma thesis, Poltekkes KemenkesTanjungkarang.

Dita, Kalariza Adma (2023) PEMBUATAN GIGI TIRUAN SEBAGIAN LEPASAN AKRILIK RAHANG BAWAH KLASIFIKASI KENNEDY KELAS III MODIFIKASI 1 PADA KASUS PENYEMPITAN EDENTULOUS. Diploma thesis, Poltekkes KemenkesTanjungkarang.

E

EFENDI, EVITHA ADHE RAHMA (2023) FAKTOR-FAKTOR YANG BERHUBUNGAN DENGAN KEPATUHAN PERAWAT DALAM MELAKSANAKAN FIVE MOMENT HAND HYGIENE DI RUANG BEDAH RSUD DR. H. ABDUL MOELOEK PROVINSI LAMPUNG TAHUN 2023. Diploma thesis, Poltekkes Kemenkes Tanjungkarang.

EFENDI, MUHAMMAD RAMADHAN (2023) HUBUNGAN FAKTOR LINGKUNGAN DAN PRILAKU TERHADAP KEJADIAN DBD DI WILAYAH KERJA PUSKESMAS RAWAT INAP KEMILING KECAMATAN KEMILING KOTA BANDAR LAMPUNG TAHUN 2023. Diploma thesis, Poltekkes Kemenkes Tanjung Karang.

EGI GHAIDA, TSURAYA (2023) GAMBARAN ASUPAN NATRIUM DAN KALIUM PADA PENDERITA HIPERTENSI LANSIA DI WILAYAH KERJA PUSKESMAS BUMI AGUNG KABUPATEN LAMPUNG UTARA. Diploma thesis, POLTEKKES KEMENKES TANJUNGKARANG.

EKA SAFITRI, DESI (2023) PEMANFAATAN LIMBAH SERBUK GERGAJI KAYU UNTUK PEMBUATAN ARANG AKTIF TAHUN 2023. Diploma thesis, POLTEKKES KEMENKES TANJUNGKARANG.

ELISA, ELISA (2023) HUBUNGAN SANITASI DASAR DENGAN KEJADIAN DIARE PADA MASYARAKAT DI WILAYAH KERJA PUSKESMAS GEDONG AIR KOTA BANDAR LAMPUNG TAHUN 2023. Diploma thesis, Poltekkes Kemenkes Tanjung Karang.

ELMA TIARA, SINTA (2023) GAMBARAN PERILAKU HIDUP BERSIH DAN SEHAT (PHBS) PADA SISWA SEKOLAH DASAR DI KECAMATAN BATU KETULIS KABUPATEN LAMPUNG BARAT TAHUN 2023. Diploma thesis, POLTEKKES KEMENKES TANJUNGKARANG.

ELMAS, ZAQI MU’AWANAH (2023) GAMBARAN PENDERITA TUBERKULOSIS PARU DENGAN KOINFEKSI HIV DI KOTA BANDAR LAMPUNG TAHUN 2020-2022. Diploma thesis, Poltekkes KemenkesTanjungkarang.

ELTSEINAYAAM, YASMINE (2023) GAMBARAN STATUS GIZI, ASUPAN ZAT GIZI MAKRO DAN AKTIVITAS FISIK PADA ANAK SEKOLAH DASAR DI SLBN PKK PROVINSI LAMPUNG. Diploma thesis, Poltekkes KemenkesTanjungkarang.

ENDRIANTI, ERICHA (2023) ASUHAN KEPERAWATAN GANGGUAN RASA NYAMAN NYERI AKUT DENGAN INTERVENSI RELAKSASI AUTOGENIK PADA IBUPOST PARTUM SECTIO CAESAREA DI RSUD JENDRAL AHMADYANI KOTA METRO TAHUN 2023. Diploma thesis, Poltekkes Kemenkes Tanjungkarang.

ERDAS, LADISA MERU (2023) SWAMEDIKASI OBAT PEREDA NYERI PADA MASYARAKAT DESA KESUMADADI KABUPATEN LAMPUNG TENGAH. Diploma thesis, Poltekkes KemenkesTanjungkarang.

ERFANDA, RAHMAT (2023) ASUHAN KEPERAWATAN DENGAN GANGGUAN OKSIGENASI PADA PASIEN ASMA TERHADAP TN. A DI RUANG FRESIA LANTAI 4 RUMAH SAKIT HANDAYANI KOTABUMI TANGGAL 13-15 NOVEMBER 2022. Diploma thesis, Poltekkes Kemenkes Tanjungkarang.

ERLINA, SAPTARIA AYU (2023) Pengaruh Mengunyah Buah Strawberry Terhadap Indeks Plak Pada Siswa Kelas V SDN 5 Tanjung Harapan Tahun 2023. Diploma thesis, Poltekkes Kemenkes Tanjungkarang.

ERLINAWATI, ERLINAWATI (2023) IMPLEMENTASI AROMATERAPI DENGAN MASALAH KEPERAWATAN ANSIETASPADA PASIEN POST OPERASI VARIKOKEL DIRUMAH SAKIT BHAYANGKARAPOLDALAMPUNG TAHUN2023. Diploma thesis, Poltekkes Kemenkes Tanjungkarang.

ERLINDA, ERLINDA (2023) PENERAPAN PERMAINAN ENGKLEK UNTUK MENINGKATKAN MOTORIK KASAR PADA ANAK. Diploma thesis, Poltekkes Kemenkes Tanjungkarang.

ERMAWATI, LEKOK (2023) ASUHAN KEPERAWATAN GANGGUAN KEBUTUHAN RASA NYAMAN PADA PASIEN HIPERTENSI DI RUMAH SAKIT BHAYANGKARA POLDA LAMPUNG TAHUN 2023. Diploma thesis, Poltekkes KemenkesTanjungkarang.

F

FACHRI NASA, MUHAMMAD (2023) GAMBARAN PENGELOLAAN LIMBAH MEDIS PADAT DI RUMAH SAKIT JIWA DAERAH PROVINSI LAMPUNG TAHUN 2023. Diploma thesis, POLTEKKES KEMENKES TANJUNGKARANG.

FADHILA, AZ ZAHRA CAHYA (2023) UJI DAYA HAMBAT EKSTRAK BUAH MENGKUDU (Morinda citrifolia) TERHADAP PERTUMBUHAN JAMUR Aspergillus flavus. Diploma thesis, Poltekkes Kemenkes Tanjungkarang.

FADHILA, HANIF (2023) GAMBARAN PENGELOLAAN LIMBAH MEDIS PADAT COVID-19 DI RUMAH SAKIT NATAR MEDIKA KABUPATEN LAMPUNG SELATAN TAHUN 2023. Diploma thesis, POLTEKKES KEMENKES TANJUNGKARANG.

FADHILA, IRFAN (2023) GAMBARAN KONDISI RUMAH PENDERITA TB PARU WILAYAH KECAMATAN SUKABUMI TAHUN 2023. Diploma thesis, POLTEKKES KEMENKES TANJUNGKARANG.

FADIL, MUHAMMAD NURSAL (2023) PENGELOLAAN SAMPAH DI PASAR RAKYAT PEKALONGAN KABUPATEN LAMPUNG TIMUR. Diploma thesis, POLTEKKES KEMENKES TANJUNGKARANG.

FADILLA, AULY ADHEA (2023) GAMBARAN SELF MANAGEMENT PASIEN DIABETES MELLITUS TIPE 2 DI PUSKESMAS RAJABASA INDAH BANDAR LAMPUNG. Diploma thesis, Poltekkes KemenkesTanjungkarang.

FADILLA, INTAN (2023) GAMBARAN POLA KONSUMSI MAKANAN SIAP SAJI (FAST FOOD), PENGETAHUAN DAN STATUS GIZI PADA REMAJA DI SMP N 22 BANDAR LAMPUNG. Diploma thesis, Poltekkes KemenkesTanjungkarang.

FADIYANTI, MARVA AFRIZA (2023) ASUHAN KEPERAWATAN GANGGUAN KEBUTUHAN AKTIVITAS PADA PASIEN STROKE NON HEMORAGIK DI RS TK.IV.02.07.04 DENKESYAH 02.04.03 KOTA BANDAR LAMPUNG TAHUN 2023. Diploma thesis, Poltekkes Kemenkes Tanjungkarang.

FAHRA, NAVISA HERMANIA (2023) ASUHAN KEPERAWATAN ANAK DENGAN GANGGUAN KEBUTUHAN RASA NYAMAN PADA KASUS CEDERA KEPALA RINGAN (CKR) TERHADAP An. V DI RUANG EDELWEIS RSU HANDAYANI KOTABUMI LAMPUNG UTARA TANGGAL 4-6 APRIL 2023. Diploma thesis, Poltekkes Kemenkes Tanjungkarang.

FAISAL, MUHAMMAD (2023) ASUHAN KEPERAWATAN PASIEN DENGAN GANGGUAN KEAMANAN & PROTEKTIF POST OPERASI TUTUP STOMA PADA KASUS POST ILEUSTOMY TERHADAP Tn. A DI RUANG BEDAH UMUM RSUD AHMAD YANI METRO TANGGAL 31 OKTOBER - 2 NOVEMBER 2022. Diploma thesis, Poltekkes Kemenkes Tanjungkarang.

FAKSI, NURUL AUDINA (2023) GAMBARAN PENGELOLAAN OBAT DI APOTEK ASYIFA LIWA KECAMATAN BALIK BUKIT KABUPATEN LAMPUNG BARAT. Diploma thesis, Poltekkes KemenkesTanjungkarang.

FANELA, ARIA BELLA (2023) ASUHAN KEPERAWATAN GANGGUAN KEBUTUHAN RASA NYAMAN (NYERI) PADA PASIEN POST OPERASI SOFT TISSUE TUMOR PUNGGUNG DI RUANG MAWAR RUMAH SAKIT DKT BANDAR LAMPUNG TAHUN 2023. Diploma thesis, Poltekkes KemenkesTanjungkarang.

FARAMITA, DELIA (2023) ASUHAN KEPERAWATAN GANGGUAN KEBUTUHAN CAIRAN PADA PASIEN DENGUE HAEMORHAGIC FEVER (DHF) DI RUMAH SAKIT BHAYANGKARA POLDA LAMPUNG TAHUN 2023. Diploma thesis, Poltekkes KemenkesTanjungkarang.

FATHONAH, BINTA SUFIA ZALIAL (2023) PENERAPAN PEMBERIAN AROMATERAPI MAWAR UNTUK MEMINIMALISIR NYERI PADA PERSALINAN KALA 1 FASE AKTIF TERHADAP NY. A DI PMB RISTIANA, S.ST LAMPUNG SELATAN. Diploma thesis, Poltekkes Kemenkes Tanjungkarang.

FATIKHAH, ARTIA NUR (2023) ASUHAN KEBIDANAN PADA ANAK PRA SEKOLAH G DENGAN PERKEMBANGAN MERAGUKAN PADA ASPEK KEMANDIRIAN DI TEMPAT PRAKTIK MANDIRI BIDAN KEC. LAMBU KIBANG TULANG BAWANG BARAT. Diploma thesis, Poltekkes Tanjungkarang.

FATMA, YUNIAR (2023) PERBANDINGAN JUMLAH DAN JENIS LEUKOSIT PASIEN TB PARU SEBELUM DAN SESUDAH PENGOBATAN OAT FASE INTENSIF DI KABUPATEN LAMPUNG TENGAH TAHUN 2023. Diploma thesis, Poltekkes Kemenkes Tanjungkarang.

FATMAWATI, WIDIA (2023) ASUHAN KEPERAWATAN GANGGUAN KEBUTUHAN RASA NYAMAN PADA KLIEN HIPERTENSI DI DUSUN SRIMULYO 1 DESA PEMANGGILAN KECAMATAN NATAR KABUPATEN LAMPUNG SELATAN TAHUN 2023. Diploma thesis, Poltekkes KemenkesTanjungkarang.

FAUZIAH, FARIDATUL (2023) PARASITE FORMULA PENDERITA MALARIA DI UPT PUSKESMAS MAJA KECAMATAN MARGA PUNDUH KABUPATEN PESAWARAN TAHUN 2022. Diploma thesis, POLTEKKES KEMENKES TANJUNGKARANG.

FAZALIA, SELLA NANTISE (2023) PENGARUH PENYULUHAN DENGAN MEDIA PUZZLE TERHADAP PENGETAHUAN KESEHATAN GIGI ANAK USIA DINI TK AL-HAIRIAH TAHUN 2023. Diploma thesis, Poltekkes Kemenkes Tanjungkarang.

FEBRIANI, INDAH SARIP (2023) EFEKTIVITAS MENGUNYAH BENGKOANG TERHADAP INDEKSDEBRIS PADA SISWA KELAS V DI SDN 51 KRUI PESISIR BARAT TAHUN 2023. Diploma thesis, Poltekkes Kemenkes Tanjungkarang.

FEBRIANI, NURIA (2023) GAMBARAN BORAKS PADA MIE BASAH YANG DIJUAL DI PASAR TRADISIONAL KOTA BANDAR LAMPUNG TAHUN 2023. Diploma thesis, Poltekkes KemenkesTanjungkarang.

FEBRITALIA, TIARA (2023) PENGARUH MENGUNYAH BUAH JERUK TERHADAP PERUBAHAN DEBRIS INDEKSPADA SISWA/I KELAS V SDN 3 KEMILING PERMAI KECAMATAN KEMILING BANDAR LAMPUNG TAHUN 2023. Diploma thesis, Poltekkes Kemenkes Tanjungkarang.

FEBRIYANTI, ANNISYA (2023) GAMBARAN KONDISI SANITASI DASAR DAN PHBS RUMAH TANGGA PADA PENDERITA DIARE DI WILAYAH KERJA PUSKESMAS RAWAT INAP TANJUNG RAJA KABUPATEN LAMPUNG UTARA TAHUN 2023. Diploma thesis, POLTEKKES KEMENKES TANJUNGKARANG.

FEBRIYANTI, HERLINA (2023) ASUHAN KEPERAWATAN KELUAGA DENGAN GANGGUAN AKTIVITAS PADA KASUS GOUT ARTHRITIS TERHADAP Ny.S DI DESA BANDAR PUTIH WILAYAH KERJA PUSKESMAS KOTABUMI II KABUPATEN LAMPUNG UTARA TANGGAL 21-23 OKTOBER 2022. Diploma thesis, Poltekkes Kemenkes Tanjungkarang.

FIRDA YUNITA, RINI (2023) GAMBARAN PENGETAHUAN, SIKAP HYGIENE DAN SANITASI TENAGA PENGOLAH MAKANAN DI PONDOK PESANTREN ROUDLOTUS SHOLIHIN GUNUNG TERANG LAMPUNG BARAT TAHUN 2023. Diploma thesis, POLTEKKES KEMENKES TANJUNGKARANG.

FIRDAUSI, ANISA WULAN (2023) EVALUASI TERAPI OBAT DIARE PADA PASIEN BALITA RAWAT JALAN DI PUSKESMAS KEMILING BANDAR LAMPUNG TAHUN 2022. Diploma thesis, Poltekkes KemenkesTanjungkarang.

FIRNANDO, MUHAMMAD RIFKI FERY (2023) ASUHAN KEPERAWATAN GANGGUAN MOBILITAS FISIK POST OPERASI LAPARATOMI EKSPLORASI DENGAN PERITONITIS DI RSUD JEND. AHMAD YANI KOTA METRO TAHUN2023. Diploma thesis, Poltekkes Kemenkes Tanjungkarang.

FITRI, GEMA ADELIA (2023) ASUHAN KEPERAWATAN PASIEN DENGAN GANGGUAN SIRKULASI PADA KASUS ANEMIA TERHADAP Ny. B DI RUANG FREESIA RSU HANDAYANI KOTABUMI LAMPUNG UTARA TANGGAL 11-13 OKTOBER 2022. Diploma thesis, Poltekkes Kemenkes Tanjungkarang.

FITRIA, ANNISA (2023) GAMBARAN FAKTOR EKSTERNAL DAN SISA MAKANAN BIASA PASIEN RAWAT INAP KELAS III DI RUMAH SAKIT ADVENT BANDAR LAMPUNG TAHUN 2023. Diploma thesis, POLTEKKES KEMENKES TANJUNGKARANG.

FITRIA, FITRIA (2023) PEMANFAATAN BELIMBING WULUH (Averrhoa bilimbi L.) TERHADAP PENURUNAN KADAR TIMBAL (Pb) PADA KERANG HIJAU (Perna viridis). Diploma thesis, Poltekkes KemenkesTanjungkarang.

FITRIANA, RIKA (2023) GAMBARAN CITARASA DAN SISA MAKANAN LUNAK PADA PASIEN RAWAT INAP DI RUMAH SAKIT DAERAH DR. A DADI TJOKRODIPO BANDAR LAMPUNG TAHUN 2023. Diploma thesis, Poltekkes KemenkesTanjungkarang.

FITRIANI, ELY (2023) SKRINING FITOKIMIA DAN UJI AKTIVITAS ANTIOKSIDAN EKSTRAK ETANOL DAUN SALAM (Syzygium Polyanthum (Wight) Walp) DENGAN METODE DPPH. Diploma thesis, Poltekkes KemenkesTanjungkarang.

FITRIANI, SELVIA (2023) GAMBARAN PENGGUNAAN OBAT TRADISIONAL BERLOGO DALAM SWAMEDIKASI DI KECAMATAN SEKINCAU KABUPATEN LAMPUNG BARAT TAHUN 2023. Diploma thesis, Poltekkes KemenkesTanjungkarang.

FITRIANI, YUNI (2023) ASUHAN KEPERAWATAN PASIEN DENGAN GANGGUAN KEBUTUHAN CAIRAN DAN ELEKTROLIT TERHADAP TN. W PADA KASUS SIROSIS HEPATIS DI RUANG PENYAKIT DALAM B RSUD AHMAD YANI METRO TANGGAL 14-16 NOVEMBER 2022. Diploma thesis, Poltekkes Kemenkes Tanjungkarang.

FITRIYANI, DEVI (2023) PENGARUH TERAPI KOMPRES HANGAT DAN AROMATERAPI LAVENDER TERHADAP NYERI PADA PASIEN POST OPERASI SECTIO CAESAREA DI RSUD Dr. H. ABDUL MOELOEK PROVINSI LAMPUNG TAHUN 2023. Diploma thesis, Poltekkes Kemenkes Tanjungkarang.

FITRIYANI, FITRIYANI (2023) PEMANFAATAN LIMBAH CAIR TAHU SEBAGAI PUPUK ORGANIK CAIR DENGAN PENAMBAHAN BIOAKTIVATOR EM4 TAHUN 2023. Diploma thesis, Poltekkes Tanjungkarang.

FORTUNA, MUTIARA ADINIL (2023) ASUHAN KEPERAWATAN GANGGUAN KEBUTUHAN TERMOREGULASI PADA PASIEN TYPHOID DI RS BHAYANGKARA POLDA LAMPUNG TAHUN 2023. Diploma thesis, Poltekkes KemenkesTanjungkarang.

FRENSINTIA, YENI (2023) ASUHAN KEBIDANAN BAYI BARU LAHIR NORMAL DI TEMPAT PRAKTIK MANDIRI BIDAN KARTINI LAMBU KIBANG TULANG BAWANG BARAT. Diploma thesis, Poltekkes Tanjungkarang.

FURQONI, FAQIH ALI AKBAR (2023) ASUHAN KEPERAWATAN GANGGUAN KEBUTUHAN AKTIVITAS DAN LATIHAN PADA KLIEN STROKE NON HEMORAGIK DI DUSUN SRIMULYO I DESA PEMANGGILAN KECAMATAN NATAR KABUPATEN LAMPUNG SELATAN PROVINSI LAMPUNG TAHUN 2023. Diploma thesis, Poltekkes KemenkesTanjungkarang.

Fauzia, Vina Noufal (2023) PENATALAKSANAAN ANEMIA RINGAN PADA IBU HAMIL DENGAN UMBI-UMBIAN TINGGI FE DI PMB KARMILA ASTUTI, SST LAMPUNG SELATAN. Diploma thesis, Poltekkes Kemenkes Tanjungkarang.

Fauziah, Alfina (2023) PEMBUATAN GIGI TIRUAN SEBAGIAN LEPASAN AKRILIK RAHANG ATAS KLASIFIKASI KENNEDY KELAS III MODIFIKASI 2 DAN RAHANG BAWAH KELAS II MODIFIKASI 2 DENGAN KASUS EKSTRUSI DAN MESIOVERSI. Diploma thesis, Poltekkes KemenkesTanjungkarang.

Fitriyani, Cut Devi (2023) GAMBARAN MINAT BERWIRAUSAHA MAHASISWA TEKNIK GIGI POLITEKNIK KESEHATAN TANJUNGKARANG TAHUN AKADEMIK 2022/2023. Diploma thesis, Poltekkes KemenkesTanjungkarang.

Fitriyani, Riska (2023) GAMBARAN SKRINING RESEP PASIEN RAWAT JALAN DI RUMAH SAKIT PERTAMINA BINTANG AMIN PERIODE DESEMBER TAHUN 2022. Diploma thesis, Poltekkes KemenkesTanjungkarang.

Fitroh, Khusnul (2023) GAMBARAN TATA RUANG LABORATORIUM TEKNIK GIGI POLITEKNIK KESEHATAN TANJUNGKARANG. Diploma thesis, Poltekkes KemenkesTanjungkarang.

G

GANDA, YASPATI (2023) SISTEM PENGELOLAAN LIMBAH MEDIS B3 PUSKESMAS RAWAT INAP SIMPUR TANJUNGKARANG PUSAT TAHUN 2023. Diploma thesis, Poltekkes Kemenkes Tanjung Karang.

GEBRIELLA SIHOMBING, PUTRI (2023) RINGKASAN Pytiriasis versicolor (PV) adalah infeksi jamur kulit kronis yang disebabkan oleh proliferasi ragi lipofilik (Malassezia spesies) di stratum korneum. Spesies Malassezia yang paling umum yang terkait dengan PV adalah M. globosa, dengan M. sympodialis dan M. furfur juga sering terlihat. Insiden yang akurat di Indonesia belum ada namun diperkirakan 40-50% dari populasi di negara tropis terkena penyakit ini, sedang di negara subtropics yaitu Eropa tengah dan utara hanya 0,5-1% dari semua penyakit jamur. Tujuan Umum penelitian ini untuk Mengetahui Gambaran Faktor Personal Hygiene dan Sanitasi LingkunganRumah Penderita Phytiriasis Versicolor yang meliputi suhu, kelembaban, kepadatan hunian, kebersihan kulit, kebersihan tangan dan kebiasaan mengganti pakaian. Penelitian ini dilakukan dengan metode deskriptif terhadapa 374 orang dan 79 sampel yang diambil dengan cara random sampling diwilayah kerja Puskesmas Ngarip Kabupaten Tanggamus 2022Dari hasil penelitian didapatkan hasil kebersihan kulit 74,7% TMS kebersihan tangan 74,7% TMS, kebersihan pakaia 70,9% TMS, Sanitasi lingkungan seperti Suhu 39,7% TMS, kelembaban 39,7% TMS. Kepadatan hunian 66,7% TMS, Saran perlu adanya penanganan dan penyuluhan dari dinas terkait untuk penyakit pytiriasis Versicolor. Menurut penelitian yang dilakukan oleh Wardana 2017 di Lampung, mengungkapkan bahwa factor hygiene yang buruk merupakan factor risiko terjadinya penyakit Phityriasis Versicolor. Begitu juga Mustofa (2014) di Semarang, tingkat hygiene perorangan yang buruk merupakan factor risiko terjadinya infeksi Pytiriasis versicolor dan individu yang memiliki personal hygiene yang baik namun tetap terdiagnosis Phitiriasis versicolor dapat disebabkan oleh variable perancu lain yang tidak diteliti pada penelitian, yaitu tingkat imunitas yang rendah, dan tidak menjaga asupan nutrisi dengan baik juga dapat mengakibatkan terjadinya Phitiriasis versicolor Kata Kunci : Pytiriasis versicolor, Hygiene Sanitasi Daftar bacaan : 15 (2006-2022. Diploma thesis, POLTEKKES KEMENKES TANJUNGKARANG.

GEBRIELLA SIHOMBING, PUTRI (2023) SANITASI LINGKUNGAN RUMAH BALITA STUNTING DI WILAYAH KERJA PUSKEMAS KARANG REJO METRO UTARA TAHUN 2023. Diploma thesis, POLTEKKES KEMENKES TANJUNGKARANG.

GIRI, KOMANG TIARA KORIDEVANI (2023) IMPLEMENTASI AROMATERAPI ESSENTIAL OILLAVENDERPADA PASIEN DENGAN MASALAH NYERI AKUT POST OPERASI APPENDECTOMY DIRS MARDI WALUYO KOTA METRO TAHUN 2023. Diploma thesis, Poltekkes Kemenkes Tanjungkarang.

GITA NOVITA DEWI, GITA (2023) GAMBARAN ASUPAN PURIN, AKTIVITAS FISIK STATUS GIZI DAN KADAR ASAM URAT PADA PENDERITA GOUT DI WILAYAH KERJA PUSKESMAS KEBUN TEBU LAMPUNG BARAT. Diploma thesis, POLTEKKES KEMENKES TANJUNGKARANG.

GUMILAR, RADIANT RATRI (2023) HUBUNGAN PERSYARATAN KESEHATAN RUMAH TINGGAL DAN PAPARAN ASAP ROKOK TERHADAP KEJADIAN PENYAKIT ISPA PADA BALITA DI DESA BUNUT KECAMATAN WAY RATAI KABUPATEN PESAWARAN TAHUN 2023. Diploma thesis, Poltekkes Tanjungkarang.

GUSNIA, HANI (2023) ASUHAN KEPERAWATAN PASIEN DENGAN GANGGUAN TERMOREGULASI PADA KASUS OBSERVASI FEBRIS TERHADAP AN. A DI RUANG EDELWIS LANTAI 2 RSU HANDAYANI KOTABUMI LAMPUNG UTARA TANGGAL 03-05 APRIL 2023. Diploma thesis, Poltekkes Kemenkes Tanjungkarang.

GUSTIANA, ANNISA (2023) ASUHAN KEPERAWATAN GANGGUAN KEBUTUHAN KEAMANAN PROTEKSI THERMOGULASI PADA PASIEN DHF DAN KEJANG DEMAM RUANGAN ALAMANDA RSUD Dr. H. ABDUL MOELOEK BANDAR LAMPUNG TAHUN 2023. Diploma thesis, Poltekkes KemenkesTanjungkarang.

GUSTIANA SATRA, DEWI (2023) ASUHAN KEPERAWATAN PADA PASIEN ULKUS DIABETIKUM POST DEBRIDEMENT DENGAN MASALAH KEPERAWATAN GANGGUAN INTEGRITAS JARINGAN DI RS BHAYANGKARA POLDA LAMPUNG TAHUN 2023. Diploma thesis, Poltekkes Kemenkes Tanjungkarang.

GUSTINAVESTA, FLORENTIKA (2023) FORMULASI KOMBINASI GEL LIDAH BUAYA (Aloe vera L.) DAN MINYAK BIJI KELOR (Moringa oleifera L.) SEBAGAI KRIM PELEMBAB DAN ANTIOKSIDAN. Diploma thesis, Poltekkes KemenkesTanjungkarang.

Ginting, Meita Reskina (2023) PEMBUATAN GIGI TIRUAN SEBAGIAN LEPASAN AKRILIK PARADENTAL RAHANG BAWAH DENGAN PENYEMPITAN EDENTULOUS. Diploma thesis, Poltekkes KemenkesTanjungkarang.

Gunanda, Niken Dhea (2023) PROSEDUR PEMBUATAN GIGI TIRUAN SEBAGIAN LEPASAN AKRILIK DENGAN KEHILANGAN GIGI 15 16 26 35 36 DAN 46 PADA KASUS EDENTULOUS AREA YANG SEMPIT. Diploma thesis, Poltekkes KemenkesTanjungkarang.

H

HABIBI, MUHAMMAD YASIN (2023) FAKTOR RISIKO YANG BERHUBUNGAN DENGAN KEJADIAN STUNTING PADA ANAK BALITA DI WILAYAH KERJA PUSKESMAS MARGOTOTO LAMPUNG TIMUR TAHUN 2023. Diploma thesis, Poltekkes Tanjungkarang.

HADI PRATIWI, ISNENDA (2023) GAMBARAN SANITASI LINGKUNGAN PADA RUMAH PENDERITA DIARE DI WILAYAH KERJA PUSKESMAS BANDAR JAYA KECAMATAN TERBANGGI BESAR KABUPATEN LAMPUNG TENGAH TAHUN 2023. Diploma thesis, POLTEKKES KEMENKES TANJUNGKARANG.

HAIRANI, DARARO (2023) GAMBARAN HYGIENE SANITASI MAKANAN DI RSD MAYJEN H.M. RYACUDU KOTABUMI TAHUN 2023. Diploma thesis, POLTEKKES KEMENKES TANJUNGKARANG.

HAJAR, SITI (2023) GAMBARAN PERILAKU MASYARAKAT TERHADAP ISU OBAT SIRUP TERKAIT GAGAL GINJAL AKUT PADA ANAK DI WILAYAH KERJA PUSKESMAS KEMILING DAN PANJANG KOTA BANDAR LAMPUNG. Diploma thesis, Poltekkes KemenkesTanjungkarang.

HAKIM, IRFAN FAISHAL (2023) EVALUASI PERESEPAN OBAT PADA PASIEN ISPA BERDASARKAN INDIKATOR WHO (WORLD HEALTH ORGANIZATION) DI PUSKESMAS BANDAR SRIBHAWONO KECAMATAN BANDAR SRIBHAWONO KABUPATEN LAMPUNG TIMUR. Diploma thesis, Poltekkes KemenkesTanjungkarang.

HALIMAH, LAILA (2023) ASUHAN KEPERAWATAN GERONTIK DENGAN GANGGUAN KEBUTUHAN RASA NYAMAN PADA KASUS HIPERTENSI TERHADAP TN. E DI KOTA ALAM WILAYAH KERJA PUSKESMAS KOTABUMI II KABUPATEN LAMPUNG UTARA TANGGAL 31 OKTOBER-03 NOVEMBER 2022. Diploma thesis, Poltekkes Kemenkes Tanjungkarang.

HALIMATUSAKDIAH, ADINDA (2023) ASUHAN KEBIDANAN PADA BADUTA DENGAN PERKEMBANGAN MERAGUKAN ASPEK MOTORIK HALUS DAN MOTORIK KASAR DENGAN METODE PUZZLE DAN SENAM JARI DI TEMPAT PRAKTIK MANDIRI BIDAN FITRIYANA KECAMATAN TRIMURJO LAMPUNG TENGAH. Diploma thesis, Poltekkes Tanjungkarang.

HALIZAH, SINDI NUR (2023) ASUHAN KEPERAWATAN KELUARGA DENGAN GANGGUAN KEBUTUHAN NUTRISI PADA KASUS DIABETES MELITUS TERHADAP NY S DI DESA BANDAR PUTIH WILAYAH KERJA PUSKESMAS KOTABUMI II KECAMATAN KOTABUMI SELATAN KABUPATEN LAMPUNG UTARA TANGGAL 17-19 OKTOBER 2022. Diploma thesis, Poltekkes Kemenkes Tanjungkarang.

HAMAS UGI PRAYOGI, HAMAS UGI (2023) ASUHAN KEPERAWATAN PASIEN DENGAN GANGGUAN OKSIGENASI PADA KASUS BRONKITIS TERHADAP NY. N DI RUANG PARU RSD MAYJEND HM RYACUDU KOTABUMI LAMPUNG UTARA TANGGAL 24-26 OKTOBER 2022. Diploma thesis, Poltekkes Kemenkes Tanjungkarang.

HANDAYANI, CINDI DWI (2023) GAMBARAN TINGKAT PENGETAHUAN, PERILAKU PEMILIHAN JAJANAN DAN KANDUNGAN GIZI MAKANAN JAJANAN KANTIN PADA SISWA KELAS IV DAN V DI LINGKUNGAN SD AL-KAUTSAR BANDAR LAMPUNG TAHUN 2023. Diploma thesis, Poltekkes Kemenkes Tanjungkarang.

HANDAYANI, DYAH PERMATA (2023) ASUHAN KEBIDANAN PADA BAYI BARU LAHIRDENGAN BAYI BERAT LAHIR RENDAHDI TEMPAT PRAKTIK MANDIRI BIDAN WINDRA SANDRABANGUN REJOLAMPUNG TENGAH. Diploma thesis, Poltekkes Tanjungkarang.

HANDAYANI, GITA METAVIA (2023) ASUHAN KEPERAWATAN GANGGUAN RASA NYAMAN PADA PASIEN POST AMPUTASI ULKUS DIABETIKUM DENGAN INTERVENSI RELAKSASI NAFAS DALAM DI RUMAH SAKIT MARDI WALUYO KOTA METRO TAHUN 2023. Diploma thesis, Poltekkes Kemenkes Tanjungkarang.

HANDAYANI, INTAN AZIZAH (2023) PENGARUH MENGUNYAH PERMEN KARET GULA DAN NON GULA TERHADAP PH SALIVA PADA MAHASISWA TINGKAT 1 JURUSAN KESEHATAN GIGI POLTEKKES TANJUNGKARANG TAHUN 2023. Diploma thesis, Poltekkes Kemenkes Tanjungkarang.

HANDAYANI, WURI (2023) IMPLEMENTASI EDUKASI PERAWATAN STOMA PADA PASIEN POST OPERATIF COLOSTOMY DI RSUD AHMAD YANI KOTA METRO TAHUN 2023. Diploma thesis, Poltekkes Kemenkes Tanjungkarang.

HANDAYANI, YENI (2023) PENGARUH KOMBINASI TERAPI BERMAIN ORIGAMI DANKOMUNIKASITERAPEUTIKTERHADAPPERILAKUKOOPERATIFANAKUSIAPRASEKOLAHPRE OPERASIDI RSUDDr.H.ABDULMOELOEKPROVINSI LAMPUNGTAHUN 2023. Diploma thesis, Poltekkes Kemenkes Tanjungkarang.

HANDAYANI NIM :, MONICA DEWI (2023) PENGARUH RELAKSASI NAPAS DALAM MENGGUNAKAN PIPE BLOWING BALL TERHADAP SKALA NYERI ANAK POST OPERASI DI RSUD DR. H. ABDUL MOELOEK PROVINSI LAMPUNG TAHUN 2023. Diploma thesis, Poltekkes KemenkesTanjungkarang.

HANI, AGUSTIA (2023) PENERAPAN TEKNIK PELEKATAN UNTUK KEBERHASILAN MENYUSUI. Diploma thesis, Poltekkes Kemenkes Tanjungkarang.

HANISA, MERY (2023) GAMBARAN PERILAKU PETANI SAYURAN DALAM PEMAKAIAN ALAT PELINDUNG DIRI (APD) PADA SAAT PENGGUNAAN PESTISIDA DI DESA SUKARAJA KECAMATAN WAY TENONG KABUPATEN LAMPUNG BARAT TAHUN 2022. Diploma thesis, Poltekkes Tanjungkarang.

HAPSARI, ANNISA RIZQIANI (2023) ASUHAN KEPERAWATAN GANGGUAN KEBUTUHAN MOBILISASI PADA PASIEN POST PARTUM SECTIO CAESAREA DENGAN HIPERTENSI DI RSUD Dr. H. ABDUL MOELOEK PROVINSI LAMPUNG TAHUN 2023. Diploma thesis, Poltekkes KemenkesTanjungkarang.

HARAHAP, M IQBAL ALHABIB (2023) GAMBARAN KONDISI FISIK RUMAH DAN KARAKTERISTIK PENDERITA TB PARU DI WILAYAH KERJA PUSKESMAS PASAR AMBON KOTA BANDAR LAMPUNG TAHUN 2023. Diploma thesis, POLTEKKES KEMENKES TANJUNGKARANG.

HARTAMI, DWI TYAS (2023) CEMARAN RESIDU PESTISIDA ORGANOFOSFAT MAKANAN LALAPAN KUBIS (Brassica oleracea) PADA PEDAGANG DI KOTA BANDAR LAMPUNG. Diploma thesis, Poltekkes Kemenkes Tanjung Karang.

HASANAH, ISNAINI NUR (2023) GAMBARAN LINGKUNGAN RUMAH PENDERITA DEMAM BERDARAH DENGUE (DBD) DI KECAMATAN RAJABASA WILAYAH KERJA PUSKESMAS RAJABASA INDAH KOTA BANDAR LAMPUNG TAHUN 2023. Diploma thesis, POLTEKKES KEMENKES TANJUNGKARANG.

HASANAH, NUR (2023) KAJIAN PEMBUATAN KUE PUTU AYU DENGAN PENAMBAHAN TEPUNG KACANG KEDELAI DAN TEPUNG KACANG HIJAU SEBAGAI ALTERNATIF MAKANAN SELINGAN IBU HAMIL PREEKLAMPSIA. Diploma thesis, POLTEKKES KEMENKES TANJUNGKARANG.

HASIBUAN, BELLA ARYANTO (2023) PENGARUH MOBILISASI TERHADAP PROSES PENYEMBUHAN LUKA PADA PASIEN POST SECTIO CAESAREA DI RSIA ANUGERAH MEDICAL CENTER KOTA METRO PROVINSI LAMPUNG TAHUN 2023. Diploma thesis, Poltekkes Kemenkes Tanjungkarang.

HASNAH, RANIAH DAFIRA (2023) IMPLEMENTASI PERAWATAN LUKA MOIST WOUND HEALING MENGGUNAKAN MINYAK ZAITUN PADA ASUHAN KEPERAWATAN INTEGRITAS JARINGAN PASIEN POST DEBRIDEMEN DIRUMAHSAKIT MARDIWALUYOTAHUN2023. Diploma thesis, Poltekkes Kemenkes Tanjungkarang.

HATINA, NADIA INTAN (2023) ASUHAN KEPERAWATAN PADA PASIEN POSTDEBRIDEMENT ULKUS DIABETIKUM DALAM MENGATASINYERIAKUT DENGAN INTERVENSI AROMATERAPI LAVENDER DIRSUDAHMADYANIMETRO LAMPUNG TAHUN2023. Diploma thesis, Poltekkes Kemenkes Tanjungkarang.

HATINA, NADIA INTAN (2023) HUBUNGAN PERSEPSI PASIEN TERHADAP LUKA DAN NYERI DENGAN PEMENUHAN KEBUTUHAN NUTRISI PADA PASIEN POST OPERASI DIGESTIF DI RSUD Dr. H. ABDUL MOELOEK PROVINSI LAMPUNG TAHUN 2022. Diploma thesis, Poltekkes KemenkesTanjungkarang.

HAYANA, SYIFA KHUSNUL (2023) HUBUNGAN CARA MENYIKAT GIGI DENGAN TERJADINYA RESESI GINGIVA PADA LANSIA DI PANTI JOMPO TRESNA WERDHA TAHUN 2023. Diploma thesis, Poltekkes Kemenkes Tanjungkarang.

HAYUSI, AVIP SEPTIA (2023) ASUHAN KEPERAWATAN PASIEN DENGAN GANGGUAN NUTRISI DAN CAIRAN PADA KASUS POST SECTIO CAESAREA DENGAN INDIKASI PLASENTA PREVIA TERHADAP NY. S DI RUANG KEBIDANAN LANTAI 2 RSU HANDAYANI KOTABUMI LAMPUNG UTARA TANGGAL 30 MARET-1 APRIL 2023. Diploma thesis, Poltekkes Kemenkes Tanjungkarang.

HENDRAWAN, I MADE (2023) PEMBUKA DAN PENUTUP KOTAK SAMPAH OTOMATIS BERBASIS ARDUINO DAN SENSOR TAHAN AIR. Diploma thesis, Poltekkes Kemenkes Tanjung Karang.

HENDRAWAN, KAYLA AUREL LASYA (2023) ASUHAN KEPERAWATAN JIWA DENGAN GANGGUAN PERSEPSI SENSORI HALUSINASI PENDENGARAN PADA KASUS SKIZOFRENIA PARANOID TERHADAP Tn.S DI RUANG KUTILANG RUMAH SAKIT JIWA DAERAH PROVINSI LAMPUNG TANGGAL 8-10 MARET 2022. Diploma thesis, Poltekkes Kemenkes Tanjungkarang.

HENDRAWAN, PERNANDO (2023) PENGARUH SHOLAWAT NABI TIBBIL QULUB TERHADA PENURUNAN TINGKAT KECEMASAN PASIEN PRE OPERASI DI RSUD JEND AHMAD YANI METRO PROVINSI LAMPUNG TAHUN 2023. Diploma thesis, Poltekkes Kemenkes Tanjungkarang.

HEPSANDA, FARHAN HAFIZH (2023) PERBANDINGAN KUALITAS SEDIAAN DENGAN VARIASI WAKTU PEWARNAAN PADA APUSAN SITOLOGI PLEURA DENGAN METODE DIFF-QUICK DI RSUD Dr. H. ABDUL MOELOEK PROVINSI LAMPUNG. Diploma thesis, Poltekkes Kemenkes Tanjungkarang.

HERLINA, EIIS (2023) ASUHAN KEBIDANAN PADA BADUTA STUNTING DENGAN PERKEMBANGAN BICARA DAN BAHASA MERAGUKAN DI TPMBLELY YUSTIANA RAJABASA LAMA LAMPUNG TIMUR. Diploma thesis, Poltekkes Tanjungkarang.

HERMAWATI, RIA (2023) ASUHAN KEPERAWATANGANGGUAN PENYAPIHAN VENTILATOR PADA PASIEN POST CRANIOTOMY DI RUANG ICU RSUD ABDUL MOELOEK PROVINSI LAMPUNG TAHUN 2023. Diploma thesis, Poltekkes Kemenkes Tanjungkarang.

HIDAYAH, NUR (2023) EFEKTIVITAS EKSTRAK DAUN SALAM (Syzygium polyanthum) TERHADAP MORTALITAS LALAT RUMAH (Musca domestica). Diploma thesis, Poltekkes Kemenkes Tanjung Karang.

HIDAYAH, SRI MELATI NUR (2023) PENGARUH SELF RELAXOUND TERHADAPKECEMASAN PASIENPRE OPERASILAPARATOMI DI RSUDDr. H. ABDUL MOELOEK PROVINSI LAMPUNG TAHUN 2023. Diploma thesis, Poltekkes Kemenkes Tanjungkarang.

HIDAYAT, BAGUS TAUFIQ (2023) ASUHAN KEPERAWATAN GANGGUAN TERMOREGULASI PADA PASIEN THYPOID DAN PASIEN POST OPERASI KISTA DUKTUS KOLEDOKUS DI RUANG ALAMANDA RSUD Dr. H. ABDOEL MOELOEK BANDAR LAMPUNG TAHUN 2023. Diploma thesis, Poltekkes KemenkesTanjungkarang.

HIDAYAT, DENNAYA OKTI GINTARI E. (2023) UJI EFEKTIVITAS EKSTRAK DAUN SIRSAK (Annonamuricata L.) DAN DAUN SALAM (Syzygium polyanthum) DALAM MEMBUNUH KECOA AMERIKA (Periplaneta americana (L)) TAHUN 2023. Diploma thesis, POLTEKKES KEMENKES TANJUNGKARANG.

HIDAYAT, FARID (2023) FAKTOR-FAKTORYANG BERHUBUNGAN DENGAN PROSESPENYEMBUHAN LUKA POST OPERASILAPARATOMY DIRSUD Dr. H. ABDOEL MOELOEK TAHUN2022. Diploma thesis, Poltekkes Kemenkes Tanjungkarang.

HIDAYAT, FARID (2023) IMPLEMENTASI AROMATERAPI ESSENTIAL OILLAVENDER PADA PASIEN DENGAN MASALAH KEPERAWATAN NYERI AKUT POST OPERASIHERNIOTOMYDI RUANG BEDAH RS MARDI WALUYO KOTA METRO LAMPUNG TAHUN 2023. Diploma thesis, Poltekkes Kemenkes Tanjungkarang.

HIDAYAT, MUHAMMAD SYARIF (2023) GAMBARAN PENGELOLAAN LIMBAH MEDIS PADAT DI RUMAH SAKIT DAERAH DR. A. DADI TJOKRODIPO KOTA BANDAR LAMPUNG TAHUN 2023. Diploma thesis, POLTEKKES KEMENKES TANJUNGKARANG.

HIDAYAT, TAUFIK (2023) HUBUNGAN KONDISI FISIK RUMAH DAN PERILAKU MASYARAKAT DENGAN KEJADIAN TUBERKULOSIS PARU DI WILAYAH KERJA UPT PUSKESMAS RAWAT INAP KAMPUNG SAWAH KOTA BANDAR LAMPUNG TAHUN 2023. Diploma thesis, Poltekkes Kemenkes Tanjung Karang.

HISAN, ZIAN HAFIZUL (2023) ASUHAN KEPERAWATAN GANGGUAN KEBUTUHAN SIRKULASI DI RUANG PENYAKIT DALAM PADA PASIEN DENGAN ANEMIA DI RSUD DR. A. DADI TJOKRODIPO KOTA BANDAR LAMPUNG TAHUN 2023. Diploma thesis, Poltekkes KemenkesTanjungkarang.

HULWANI, AFIFAH ZATI (2023) PENGARUH MENGONSUMSI BUAH PISANG AMBON TERHADAP pH SALIVA PADA PELAJAR SMPN 06 TULANG BAWANG BARAT TAHUN 2023. Diploma thesis, Poltekkes Kemenkes Tanjungkarang.

HUSNA, AMALIA (2023) ASUHAN KEPERAWATAN GANGGUAN KEBUTUHAN NUTRISI PADA PASIEN DENGAN DIABETES MELITUS DI RUANG PENYAKIT DALAM RSUD Dr. A. DADI TJOKRODIPO KOTA BANDAR LAMPUNG TAHUN 2023. Diploma thesis, Poltekkes KemenkesTanjungkarang.

HUSNAH, ROFIATUL (2023) PENATALAKSANAAN ASUHAN GIZI TERSTANDAR PADA PASIEN PENYAKIT GERD DAN HIPERTENSI DI RSUD AHMAD YANI METRO. Diploma thesis, Poltekkes Kemenkes Tanjungkarang.

Habibah, Nurul (2023) ASUHAN KEBIDANAN PADA REMAJA DENGAN DISMENORE DI KLINIK AN NUR HUSADA KECAMATAN DAYA MURNI TULANG BAWANG BARAT. Diploma thesis, Poltekkes Tanjungkarang.

I

I DINANTI, TARA PEBRI (2023) ASUHAN KEPERAWATAN GANGGUAN NYERI AKUT PADA PASIEN POST SECTIO CAESAREA DENGAN OLIGOHIDRAMNION DI RSUD Dr. H. ABDUL MOELOEK PROVINSI LAMPUNG TAHUN 2023. Diploma thesis, Poltekkes KemenkesTanjungkarang.

I TRIYONO, OLVA NUGRAHEM (2023) HUBUNGAN DUKUNGAN SOSIAL TERHADAP TERJADINYA POST PARTUM BLUES PADA PASIEN POST OPERASI SECTIO CAESAREA DI RSIA ANUGERAH MEDICAL CENTER KOTA METRO TAHUN 2023. Diploma thesis, Poltekkes KemenkesTanjungkarang.

IHSYAN, AHMAD (2023) MANAJEMEN RISIKO KESELAMATAN PASIEN RAWAT INAP DI RUMAH SAKIT UMUM DAERAH DR. A. DADI TJOKRODIPO KOTA BANDAR LAMPUNG TAHUN 2023. Diploma thesis, Poltekkes Kemenkes Tanjung Karang.

IKHLASUL KHOFI, AHMAD (2023) GAMBARAN SISTEM PENGELOLAAN SAMPAH PASAR TEMPEL RAJABASA BANDAR LAMPUNG TAHUN 2023. Diploma thesis, POLTEKKES KEMENKES TANJUNGKARANG.

ILLAZULFA, DINA RISRIKA (2023) GAMBARAN HIGIENE SANITASI PENYELENGGARAAN MAKANAN DAN ASUPAN ZAT GIZI MAKRO SANTRIWATI MTS DI PONDOK PESANTREN AL-FATAH NATAR TAHUN 2023. Diploma thesis, POLTEKKES KEMENKES TANJUNGKARANG.

IMAMAH, SARAH NUR and UNSPECIFIED (2023) ANALISIS KUALITAS MAKANAN SECARA MIKROBIOLOGI PADA MAKANAN JAJANAN DI SEKOLAH DASAR KECAMATAN RAJABASA TAHUN 2023. Diploma thesis, Poltekkes Kemenkes Tanjung Karang.

IMAN, SRI WAHYUNI (2023) ASUHAN KEPERAWATAN GANGGUAN KEBUTUHAN OKSIGENASI PADA PASIEN ASMA DI DESA SRIMULYO PEMANGGILAN NATAR LAMPUNG SELATAN TAHUN 2023. Diploma thesis, Poltekkes KemenkesTanjungkarang.

INDRIYANA, MIA NISKA (2023) HUBUNGAN TINGKAT NYERI DENGAN PEMENUHAN ACTIVITY DAILY LIVING (ADL) PASIEN POST OPERASI DI RUANG RAWAT INAP BEDAH KUTILANG RSUD Dr. H. ABDUL MOELOEK PROVINSI LAMPUNG TAHUN 2023. Diploma thesis, Poltekkes Kemenkes Tanjungkarang.

INDRIYANI, FIFIN (2023) ASUHAN KEPERAWATAN PASIEN DENGAN GANGGUAN PERSEPSI SENSORI: HALUSINASI PENDENGARAN PADA KASUS SKIZOFRENIA PARANOID TERHADAP Nn. R DI RUANG MELATI RUMAH SAKIT JIWA DAERAH PROVINSI LAMPUNG TANGGAL 07-09 MARET 2022. Diploma thesis, Poltekkes Kemenkes Tanjungkarang.

INNAYAH, RISKA (2023) ASUHAN KEPERAWATAN GANGGUAN KEBUTUHAN OKSIGENASI PADA PASIEN PNEUMONIA DI RUMAH SAKIT BHAYANGKARA POLDA LAMPUNG TAHUN 2023. Diploma thesis, Poltekkes KemenkesTanjungkarang.

ISMAYONI, ALFI (2023) ASUHAN KEBIDANAN PADA IBU HAMIL DENGAN NYERI PUNGGUNG DI TEMPAT PRAKTIK MANDIRI BIDAN PASIR SAKTI, LAMPUNG TIMUR. Diploma thesis, Poltekkes Tanjungkarang.

ISMI, DIAN AYU NINGSIH (2023) PENGARUH AUTOGENIC RELAXATION DENGAN MEDIA AUDIOMUSIC INSTRUMENTAL TERHADAP SKALA NYERI PADA PASIEN POST SECTIO CAESAREA DI RSUD Dr. H. ABDUL MOELOEK PROVINSI LAMPUNG TAHUN 2023. Diploma thesis, Poltekkes KemenkesTanjungkarang.

ISTIKOMAH, RANI (2023) ASUHAN KEPERAWATAN GERONTIK DENGAN GANGGUAN KEBUTUHAN NUTRISI PADA KASUS DIABETES MELITUS TIPE 2 TERHADAP Tn. K DI DESA MULANG MAYA KECAMATAN KOTABUMI SELATAN KABUPATEN LAMPUNG UTARA TANGGAL 16 – 18 MARET 2023. Diploma thesis, Poltekkes Kemenkes Tanjungkarang.

ISTIQOMAH, BILQIS (2023) PENGARUH MENGUNYAH BUAH TEBU TERHADAP PENURUNAN DEBRIS INDEKS. Diploma thesis, Poltekkes Kemenkes Tanjungkarang.

Indah Suzannara, Cici (2023) PENERAPAN PEMBERIAN KUNYIT ASAM PADA REMAJA NN.S DENGAN DISMINORE PRIMER DI PMB LISNANI ALI,S.ST KECAMATAN TELUK BETUNG KOTA BANDAR LAMPUNG TAHUN 2022. Diploma thesis, Poltekkes Tanjungkarang.

Indrianie, Shantica (2023) PENATALAKSANAAN ASUHAN GIZI TERSTANDAR PADA PASIEN DIABETES MELITUS TIPE II DI RUANG RAWAT INAP RSUD BATIN MANGUNANG TANGGAMUS TAHUN 2023. Diploma thesis, POLTEKKES KEMENKES TANJUNGKARANG.

J

JANNAH, MIFTAHUL (2023) MANAJEMEN RISIKO KESELAMATAN DAN KESEHATAN KERJA PADA UNIT PELAYANAN RUMAH SAKIT MUHAMMADIYAH METRO TAHUN 2023. Diploma thesis, Poltekkes Tanjungkarang.

JATININGSIH, IKE NURLIA (2023) GAMBARAN LINGKUNGAN FISIK DAN SISTEM MANAJEMEN K3 DI PT. SINARJAYA INTI MULYA KOTA METRO TAHUN 2023. Diploma thesis, POLTEKKES KEMENKES TANJUNGKARANG.

JAUHARI, ASSYFA LINARA (2023) ASUHAN KEPERAWATAN GANGGUAN KEBUTUHAN NYAMAN PADA PASIEN DISPEPSIA DIRUANG PENYAKIT DALAM NON INFEKSIUS RSUD DR. H. ABDUL MOELOEK PROVINSI LAMPUNG TAHUN 2023. Diploma thesis, Poltekkes KemenkesTanjungkarang.

JAYA, ALDY ANDRYAN INDRA (2023) ASUHAN KEPERAWATAN NYERI AKUT DENGAN TINDAKANGENGGAMJARIPADAPASIENAPPENDIKTOMI DIRUMAH SAKIT BHAYANGKARABANDARLAMPUNG TAHUN2023. Diploma thesis, Poltekkes Kemenkes Tanjungkarang.

JAYA, SONI ARIFAN (2023) PERBEDAANEYEMASK DAN EARPLUGSTERHADAP KUALITASTIDUR PADA PASIEN POST OPERASI DI RSUD JEND. AHMAD YANI METRO TAHUN 2023. Diploma thesis, Poltekkes Kemenkes Tanjungkarang.

JAYA, TIRTA KUSUMA (2023) PERBEDAAN KEMAMPUAN PERTUMBUHAN JAMUR Aspergillus flavus PADA MEDIA ALTERNATIF TEPUNG UMBI PORANG (Amorphophallus muelleri). Diploma thesis, Poltekkes Kemenkes Tanjungkarang.

JAYA, TRIO SAMPURNA (2023) GAMBARAN FASILITAS SANITASI SEKOLAH MENENGAH ATAS NEGERI DENGAN SWASTA DI KOTA BANDAR LAMPUNG TAHUN 2023. Diploma thesis, POLTEKKES KEMENKES TANJUNGKARANG.

JAYA, YUDHI ATNA (2023) ASUHAN KEPERAWATAN PASIEN DENGAN GANGGUAN RASA AMAN NYAMAN PADA KASUS POST OPERASI APENDISITIS TERHADAP An.R DI RUANG EDELWEIS RSU HANDAYANI KOTABUMI LAMPUNG UTARA TANGGAL 22-24 MARET 2023. Diploma thesis, Poltekkes Kemenkes Tanjungkarang.

JAYSENDIRA, DAYU (2023) ASUHAN KEPERAWATAN POLA NAPAS TIDAK EFEKTIF DENGAN INTERVENSI BLOWING BALLOONS PADA PASIEN EFUSI PLEURA DENGAN WSD DI RSUD DR. H. ABDUL MOELOEK PROVINSI LAMPUNG TAHUN 2023. Diploma thesis, Poltekkes Kemenkes Tanjungkarang.

JESICA, VUNKY YESSY (2023) ASUHAN KEPERAWATAN GANGGUAN KEBUTUHAN NYERI DAN KENYAMANAN PADA PASIEN POST OP SOFT TISUE TUMOR DI RUANG BEDAH RUMAH SAKIT Dr. A. DADI TJOKRODIPO TAHUN 2023. Diploma thesis, Poltekkes KemenkesTanjungkarang.

JESIKA, OCA (2023) ANALISIS KUALITAS AIR DAN SANITASI LINGKUNGAN KOLAM RENANG UMUM DI KOTA BANDAR LAMPUNG TAHUN 2023. Diploma thesis, Poltekkes Kemenkes Tanjung Karang.

JUARIAH, SITI (2023) STUDI KASUS NYERI AKUT PADA PASIEN POST OPERASI VARIKOKEL DI RUMAH SAKIT BHAYANGKARA BANDAR LAMPUNG TAHUN 2023. Diploma thesis, Poltekkes Kemenkes Tanjungkarang.

JULIANI, SELI (2023) GAMBARAN POLA MAKAN, TINGKAT PENGETAHUAN GIZI SEIMBANG DAN STATUS GIZI WANITA PETANI KOPI DI DESA SUKANANTI KECAMATAN WAY TENONG LAMPUNG BARAT TAHUN 2023. Diploma thesis, Poltekkes KemenkesTanjungkarang.

JULIANI, SELI (2023) GAMBARAN POLA MAKAN, TINGKAT PENGETAHUAN GIZI SEIMBANG DAN STATUS GIZI WANITA PETANI KOPI DI DESA SUKANANTI KECAMATAN WAY TENONG LAMPUNG BARAT TAHUN 2023. Diploma thesis, Poltekkes KemenkesTanjungkarang.

Jannah, Lailatul (2023) GAMBARAN PENDERITA MALARIA PADA USIA PRODUKTIF DI WILAYAH KERJA PUSKESMAS PADANG CERMIN KABUPATEN PESAWARAN TAHUN 2019-2022. Diploma thesis, Poltekkes KemenkesTanjungkarang.

Jayanti, Laras Dwi (2023) ASUHAN KEPERAWATAN GANGGUAN KEBUTUHAN AKTIVITAS PADA PASIEN DENGAN STROKE HEMORAGIK DAN EPILEPSI DI RUANG BOUGENVIL RSUD. Dr. H. ABDUL MOELOEK PROVINSI LAMPUNG TAHUN 2023. Diploma thesis, Poltekkes KemenkesTanjungkarang.

K

KARISA, TIARA JEAN (2023) ANALISA KANDUNGAN FORMALIN PADA TAHU PUTIH. Diploma thesis, Poltekkes KemenkesTanjungkarang.

KAROMAH, NAMIRA DAROJATUL (2023) EFEKTIVITASPENGGUNAANGELBUAHNAGAMERAHSEBAGAI DISCLOSING PENGUKURAN PLAK. Diploma thesis, Poltekkes Kemenkes Tanjungkarang.

KARTINI, WAYAN INTAN (2023) ASUHAN KEPERAWATAN GANGGUAN KEBUTUHAN AKTIVITAS PADA PASIEN SECTIO CAESAREA DENGAN PREEKLAMSI BERAT DI RSUD Dr. H. ABDUL MOELOEK PROVINSI LAMPUNG TAHUN 2023. Diploma thesis, Poltekkes KemenkesTanjungkarang.

KARUA, VALLERISIA (2023) PERBANDINGAN PERTUMBUHAN JAMUR Aspergillus flavus PADA MEDIA ALTERNATIF KACANG HIJAU (Vigna radiata L.) YANG DITAMBAHKAN SUKROSA DENGAN MEDIA PDA (Potato Dextrose Agar) SEBAGAI KONTROL KECEPATAN PERTUMBUHAN JAMUR. Diploma thesis, Poltekkes Kemenkes Tanjungkarang.

KASIFA, RENISA (2023) GAMBARAN VARIASI MENU DAN ASUPAN ZAT GIZI PADA MAKANAN SEHARI DI PONDOK PESANTREN DAARUL IKROM KEDONDONG PESAWARAN LAMPUNG TAHUN 2023. Diploma thesis, POLTEKKES KEMENKES TANJUNGKARANG.

KAUSAR, FADILLAH IMANIA PUTRI (2023) HUBUNGAN PERILAKU MASYARAKAT DENGAN KEJADIAN DBD DI WILAYAH KERJA PUSKESMAS PUGUNG RAHARJO KABUPATEN LAMPUNG TIMUR TAHUN 2023. Diploma thesis, Poltekkes Tanjungkarang.

KEMARE, KOMANG RATNE (2023) TINJAUAN PENGETAHUAN DAN PERILAKU MASYARAKAT TERHADAP PENYAKIT MALARIA DI DESA SUKAJAYA LEMPASING KABUPATEN PESAWARAN TAHUN 2022. Diploma thesis, Poltekkes Tanjungkarang.

KHAIRUNNISA, ALMIRA RAHMA (2023) KAJIAN PEMBUATAN TELUR GABUS KEJU DENGAN SUBSTITUSI TEPUNG HATI AYAM SEBAGAI MAKANAN SELINGAN TINGGI ZAT BESI TAHUN 2023. Diploma thesis, Poltekkes Kemenkes Tanjungkarang.

KHALISAN FIRDAUS, KINTANISA (2023) ASUHAN KEBIDANAN PADA REMAJA DENGAN DISMINORE MENGGUNAKAN METODE AKUPRESUR DI TPMB FITRIYANA TRIMURJO LAMPUNG TENGAH. Diploma thesis, Poltekkes Tanjungkarang.

KHANSA, CAHYA AULIA (2023) ASUHAN KEPERAWATAN KELUARGA DENGAN GANGGUAN RASA AMAN NYAMAN PADA KASUS RHEUMATOID ARTHRITIS TERHADAP NY. Z DI DESA KOTA ALAM WILAYAH KERJA PUSKESMAS KOTABUMI II LAMPUNG UTARA TANGGAL 7-9 NOVEMBER 2022. Diploma thesis, Poltekkes Kemenkes Tanjungkarang.

KHANTI, PARAMITA ESTI (2023) GAMBARAN KEPUASAN PASIEN TERHADAP PELAYANAN KESEHATAN GIGI DAN MULUT DI PUSKESMAS PUNGGUR TAHUN 2023. Diploma thesis, Poltekkes Kemenkes Tanjungkarang.

KHARISMAGANDES ZAHRA KHARISMA NIM. 1914301048, GANDES ZAHRA (2023) FAKTOR-FAKTOR YANG BERHUBUNGAN DENGAN WAKTU PULIH SADAR PASIEN POST OPERASI DENGAN GENERAL ANESTESI DI INSTALASI BEDAH SENTRAL RSUD Dr. H. ABDUL MOELOEK PROVINSI LAMPUNG TAHUN 2023. Diploma thesis, Poltekkes KemenkesTanjungkarang.

KHASANAH, SITI MARIFATUN (2023) PENGARUHPEMBERIANFOOT MASSAGE THERAPYTERHADAP PENURUNANINTENSITASNYERI PADAPASIEN POSTOPERASISECTIO CAESAREA DI RSU MUHAMMADIYAH METRO KOTA METRO TAHUN2022. Diploma thesis, Poltekkes Kemenkes Tanjungkarang.

KHOIRUNNISYA, NIA (2023) ASUHAN KEBIDANAN PADA IBU BERSALIN INPARTU KALA I FASE AKTIF UNTUK MENGURANGI NYERI PERSALINAN DITPMBM. EKA RINI LAMPUNG TENGAH. Diploma thesis, Poltekkes Tanjungkarang.

KHOLIFAH, EVAIRUL (2023) ASUHAN KEPERAWATAN KELUARGA DENGAN GANGGUAN RASA NYAMAN PADA KASUS GOUT ARTHRITIS TERHADAP NY. K DI WILAYAH KERJA PUSKESMAS KOTABUMI II LAMPUNG UTARA TANGGAL 31 OKTOBER - 4 NOVEMBER 2022. Diploma thesis, Poltekkes Kemenkes Tanjungkarang.

KHOLIFAH, SITI (2023) PEMANFAATAN CANGKANG KERANG DARAH (Andara granosa) SEBAGAI BAHAN PEMBUATAN BATAKO TAHUN 2023. Diploma thesis, POLTEKKES KEMENKES TANJUNGKARANG.

KHORNAINI, KHORNAINI (2023) PENERAPAN PEMBERIAN MADU UNTUK MENGATASI DIARE PADA ANAK USIA 4 TAHUN 3 BULAN PADA AN.A DI PMB WAWAT MIKE A.Md.Keb LAMPUNG SELATAN. Diploma thesis, Poltekkes Kemenkes Tanjungkarang.

KHOSIKA, NIRA ASTANA (2023) FAKTOR LINGKUNGAN DAN PERILAKU YANG BERHUBUNGAN DENGAN KEJADIAN SCABIES DI LAPAS KELAS II A KOTABUMI TAHUN 2023. Diploma thesis, Poltekkes Kemenkes Tanjung Karang.

KINANTI, KURNIA RESTI (2023) GAMBARAN PENGETAHUAN IBU,POLA ASUH DAN STATUS GIZI ANAK DI TK MA’ARIF NU MIFTAHUL HUDA TOTO PROJO KECAMATAN WAY BUNGUR KABUPATEN LAMPUNG TIMUR TAHUN 2023. Diploma thesis, POLTEKKES KEMENKES TANJUNGKARANG.

KORINA, YUNITA (2023) ASUHANKEPERAWATANPADAPASIENPOSTSCDENGANMASALAHKEPERAWATANNYERIAKUTDIRUMAH SAKITBHAYANGKARA PROVINSI LAMPUNGTAHUN2023. Diploma thesis, Poltekkes Kemenkes Tanjungkarang.

KUMALASARI, REZA INTAN (2023) EFEKTIVITAS PEMBERIAN MADU DAN TEMULAWAK TERHADAP PENINGKATAN NAFSU MAKAN PADA AN. S DI PMB SANTI YUNIARTI, S.Tr.Keb LAMPUNG SELATAN. Diploma thesis, Poltekkes Tanjungkarang.

KURNIA, FITA NURASIH (2023) GAMBARAN PEMANFAATAN TANAMAN OBAT KELUARGA (TOGA) SEBAGAI PENGOBATAN TRADISIONAL DI DESA PAJAJARAN KECAMATAN KOTAAGUNG BARAT KABUPATEN TANGGAMUS. Diploma thesis, Poltekkes Kemenkes Tanjungkarang.

KURNIA, RENDY (2023) PERBANDINGAN KUALITAS SEDIAAN APUSAN SITOLOGI PLEURA DENGAN PEWARNAAN PAPANICOLAOU DAN DIFF-QUICK DI RSUD Dr. H. ABDUL MOELOEK PROVINSI LAMPUNG. Diploma thesis, Poltekkes Kemenkes Tanjungkarang.

KURNIASIH, INDAH (2023) ASUHAN KEBIDANAN KEHAMILAN DENGAN EMESIS GRAVIDARUM DI PRAKTIK MANDIRI BIDAN APRIYANTI, S.Tr.Keb DESA SRIWANGI KECAMATAN WAY JEPARA KABUPATEN LAMPUNG TIMUR. Diploma thesis, Poltekkes Tanjungkarang.

KURNIATI, TRIEYA CLARA (2023) ASUHAN KEPERAWATAN PASIEN DENGAN GANGGUAN MOBILITAS FISIK PADA KASUS POST OPERASI SECTIO CAESAREA TERHADAP NY.B DI RUANG KEBIDANAN RSU HANDAYANI KOTABUMI LAMPUNG UTARA TANGGAL 20-22 MARET 2023. Diploma thesis, Poltekkes Kemenkes Tanjungkarang.

KURNIAWAN, ALDI (2023) GAMBARAN SANITASI SEKOLAH MENENGAH ATAS DI KECAMATAN TULANG BAWANG UDIK TAHUN 2023. Diploma thesis, POLTEKKES KEMENKES TANJUNGKARANG.

KURNIAWAN, RAHMAD (2023) GAMBARAN ANGKA BEBAS JENTIK (ABJ) DIKELURAHAN JAGABAYA II WILAYAH KERJA PUSKESMAS WAYHALIM TAHUN 2023. Diploma thesis, POLTEKKES KEMENKES TANJUNGKARANG.

KUSUMA, DITA PUJI (2023) PENATALAKSANAAN BABY MASSAGE LAVENDER ESSENTIAL OIL TERHADAP By. D USIA 9 BULAN UNTUK MENINGKATKAN KUALITAS TIDUR. Diploma thesis, Poltekkes Kemenkes Tanjungkarang.

KUSUMAWATI, ARUM (2023) GAMBARAN AKTIVITAS ENZIM SGOT DAN SGPT PADA PENDERITA TUBERKULOSIS YANG MENGKONSUMSI OAT DI PUSKESMAS SUKARAJA DAN PANJANG TAHUN 2023. Diploma thesis, Poltekkes KemenkesTanjungkarang.

Khoirunnisa, Khoirunnisa (2023) KAJIAN PEMBUATAN DIMSUM DENGAN SUBTITUSI TEPUNG KACANG KEDELAI DAN PENAMBAHAN JAMUR KUPING SEBAGAI ALTERNATIF MAKANAN TINGGI SERAT BAGI PENDERITA DIABETES MELITUS TIPE II. Diploma thesis, POLTEKKES KEMENKES TANJUNGKARANG.

Kurniawan, Adi (2023) Asuhan Keperawatan Anak Dengan Gangguan Termogulasi Pada Kasus Kejang Demam Terhadap An.M di RSU Handayani Kotabumi Kabupaten Lampung Utara Tanggal 03-05 April 2023. Diploma thesis, Poltekkes Kemenkes Tanjungkarang.

L

LABIBAH, RISTI HIYA (2023) KARAKTERISTIK DAN ASUPAN ZAT GIZI MAKRO, SERAT DAN VITAMIN C PADA PASIEN RAWAT JALAN PENYAKIT JANTUNG KORONER DI RSUD JENDERAL AHMAD YANI METRO TAHUN 2023. Diploma thesis, Poltekkes Kemenkes Tanjungkarang.

LAFINIYA, NIA (2023) ASUHAN KEBIDANAN KETERLAMBATAN BICARA DAN BAHASA DENGAN METODE ORAL MOTOR DAN MASSAGE PADA BALITA DI TPMB UMAROH DESA MARGAJAYA KECAMATAN PAGAR DEWA TULANG BAWANG BARAT. Diploma thesis, Poltekkes Tanjungkarang.

LAILATUL, KHASANAH (2023) HUBUNGAN STRESOR LINGKUNGAN DI RUANG RAWAT BEDAH DENGAN TINGKAT KENYAMANAN PASIEN DI RSUD Dr.A.DADI TJOKRODIPO KOTA BANDAR LAMPUNG TAHUN 2023. Diploma thesis, Poltekkes Kemenkes Tanjungkarang.

LAMBARA, SEPTIA PUTRI (2023) GAMBARAN RIWAYAT PEMBERIAN ASI EKSKLUSIF,STATUS PERTUMBUHAN, DAN KEJADIAN STUNTINGPADAANAK USIA 6-12 BULAN DI WILAYAH KERJA PUSKESMAS BATU BRAK LAMPUNGBARAT TAHUN 2023. Diploma thesis, POLTEKES KEMENKES TANJUNGKARANG.

LAMBARA, SYAIKE TRIA ASTI (2023) PARASITE RATE DAN PARASITE FORMULA PENDERITA MALARIA DI PUSKESMAS SUKAMAJU KECAMATAN TELUK BETUNG TIMUR KOTA BANDAR LAMPUNG TAHUN 2022. Diploma thesis, Poltekkes KemenkesTanjungkarang.

LANDIA, CINDI (2023) GAMBARAN PENGGUNAAN ALAT PELINDUNG DIRI PEKERJA PADA BAGIAN PRODUKSI DI PTPN VII UNIT BEKRI TAHUN 2023. Diploma thesis, POLTEKKES KEMENKES TANJUNGKARANG.

LATIFAH, GHALDA AYU (2023) GAMBARAN JUMLAH LEUKOSIT DAN JENIS LEUKOSIT BERDASARKAN DERAJAT KEPARAHAN PADA PASIEN COVID-19 DI RSUD Dr. H. ABDUL MOELOEK PROVINSI LAMPUNG TAHUN 2021. Diploma thesis, Poltekkes KemenkesTanjungkarang.

LATIFAH, NENENG (2023) GAMBARAN PARTISIPASI IBU DALAM PEMANFAATAN POSYANDU BALITA DI DESA KAGUNGAN PUSKESMAS PASAR SIMPANG KECAMATAN KOTA AGUNG TAHUN 2023. Diploma thesis, POLTEKKES KEMENKES TANJUNGKARANG.

LEDYTHA, THANIA AYU (2023) GAMBARAN RUMAH PENDERITA ISPA DI WILAYAH KERJA PUSKESMAS RAWAT INAP PANJANG KOTA BANDAR LAMPUNG. Diploma thesis, Poltekkes Tanjungkarang.

LEONA, RINFI APICTA (2023) GAMBARAN PENYIMPANAN BAHAN MAKANAN BASAH DAN KERING DI INSTALASI GIZI RUMAH SAKIT ARTHA BUNDA LAMPUNG TENGAH TAHUN 2023. Diploma thesis, POLTEKKES KEMENKES TANJUNGKARANG.

LESMANA, PUTRI (2023) FAKTOR- FAKTOR YANG BERHUBUNGAN DENGAN PERSALINAN SECARA SECTIO CAESAREA DI RSIA ANUGERAH MEDICAL CENTER KOTA METRO TAHUN 2023. Diploma thesis, Poltekkes Kemenkes Tanjungkarang.

LESTARI, AGUS TRIYANA (2023) ASUHAN KEBIDANAN PADA IBU BERSALIN DENGAN PENERAPAN METODE COUNTERPRESSURE DI TEMPAT PRAKTIK MANDIRI DIANA MUNZIR WAY JEPARA LAMPUNG TIMUR. Diploma thesis, Poltekkes Tanjungkarang.

LESTARI, ALVINA DWI (2023) GAMBARAN PELAKSANAAN PEMBERANTASAN SARANG NYAMUK (PSN) MASYARAKAT DI KELURAHAN SUKARAME KECAMATAN SUKARAME KOTA BANDAR LAMPUNG TAHUN 2023. Diploma thesis, POLTEKKES KEMENKES TANJUNGKARANG.

LESTARI, ANASTASYA CAHYA (2023) PENGARUH MOBILISASI DINI TERHADAP PERUBAHAN MEAN ARTERIAL PRESSURE PADA PASIEN POST OPERASI DENGAN GENERAL ANESTESI DI RSUD Dr. H. ABDUL MOELOEK PROVINSI LAMPUNG. Diploma thesis, Poltekkes KemenkesTanjungkarang.

LESTARI, DEVI (2023) GAMBARAN PENGETAHUAN, SIKAP, DAN PERILAKU MASYARAKAT DALAM UPAYA PENCEGAHAN DEMAM BERDARAH DENGUE (DBD) DI WILAYAH KERJA PUSKESMAS KARANG ANYAR KECAMATAN JATI AGUNG TAHUN 2023. Diploma thesis, POLTEKKES KEMENKES TANJUNGKARANG.

LESTARI, EMA (2023) ASUHAN KEBIDANAN PADA IBU HAMIL ANEMIA RINGAN DENGAN PEMBERIAN KURMA DAN PISANG AMBON DI TEMPAT PRAKTIK MANDIRI BIDAN M TRIMURJO LAMPUNG TENGAH. Diploma thesis, Poltekkes Tanjungkarang.

LESTARI, ENDANG AYU (2023) ASUHAN KEPERAWATAN GANGGUAN KEBUTUHAN PSIKOSOSIAL HALUSINASI PADA PASIEN SKIZOFRENIA DI RUANG NURI RUMAH SAKIT JIWA DAERAH PROVINSI LAMPUNG TAHUN 2023. Diploma thesis, Poltekkes Kemenkes Tanjungkarang.

LESTARI, INDAH (2023) HUBUNGAN DUKUNGAN KELUARGA DENGAN MOBILISASI DINI PADA PASIEN POST OPERASIDI RUANG BEDAH RSUD JENDRAL AHMAD YANI METRO TAHUN 2023. Diploma thesis, Poltekkes Kemenkes Tanjungkarang.

LESTARI, INDAH (2023) PENERAPAN PEMBERIAN JUS TOMAT DAN TABLET FE UNTUK MENINGKATKAN KADAR HEMOGLOBIN PADA IBU HAMIL TRIMESTER III DENGAN ANEMIA RINGAN TERHADAP NY.R DI PMB RISTIANA,S.ST. Diploma thesis, Poltekkes Tanjungkarang.

LESTARI, LESTARI (2023) HUBUNGAN FAKTOR LINGKUNGAN FISIK RUMAH DENGAN KEJADIAN ISPA PADA BALITA DI DESA HAJIMENA KECAMATAN NATAR KABUPATEN LAMPUNG SELATAN TAHUN 2023. Diploma thesis, Poltekkes Kemenkes Tanjung Karang.

LESTARI, MAYA (2023) ASUHAN KEPERAWATAN PASIEN DENGAN GANGGUAN TERMOREGULASI PADA KASUS DENGUE HAEMORAGIC FEVER (DHF) TERHADAP AN.A DI RUANG EDELWEIS LANTAI 2 RSU HANDAYANI KOTABUMI LAMPUNG UTARA TANGGAL 14-16 MARET 2023. Diploma thesis, Poltekkes Kemenkes Tanjungkarang.

LESTARI, MEIDIA SUCI (2023) ASUHAN KEPERAWATAN GANGGUAN NYERI AKUT DENGAN INTERVENSI AROMATHERAPI LAVENDER PADA POST KISTEKTOMI DI RSUD DR.H.ABDUL MOELOEKPROVINSI LAMPUNG TAHUN2023. Diploma thesis, Poltekkes Kemenkes Tanjungkarang.

LESTARI, NUR AULIA AYU (2023) ANALISIS PEWARNA RHODAMIN B PADA SAUS JAJANAN YANG BEREDAR DI PKOR WAY HALIM KOTA BANDAR LAMPUNG. Diploma thesis, Poltekkes KemenkesTanjungkarang.

LESTARI, PUTRI AYU (2023) ASUHAN KEPERAWATAN PASIEN DENGAN GANGGUAN NUTRISI PADA KASUS DIABETES MELITUS TIPE 2 TERHADAP Ny. S DIRUANG PENYAKIT DALAM B/SRIKANDI 3 RUMAH SAKIT UMUM DAERAH AHMAD YANI METRO TANGGAL 31 OKTOBER-02 NOVEMBER 2022. Diploma thesis, Poltekkes Kemenkes Tanjungkarang.

LESTARI, ULIK DWI (2023) GAMBARAN KEPATUHAN TENAGA KESEHATAN DALAM MENCUCI TANGAN ENAM LANGKAH DI PUSKESMAS PUNGGUR TAHUN 2023. Diploma thesis, Poltekkes Kemenkes Tanjungkarang.

LIA, ADE NURUL (2023) PENATALAKSANAAN ASUHAN GIZI TERSTANDAR PADA PASIEN DIARE DI RUANG ANAK RSU MUHAMMADIYAH METRO TAHUN 2023. Diploma thesis, Poltekkes KemenkesTanjungkarang.

LIANA, TRYSIA (2023) ASUHAN KEPERAWATAN KELUARGA DENGAN GANGGUAN AMAN NYAMAN PADA KASUS GOUT ARTHRITIS TERHADAP Tn.Z DI DESA MULANG MAYA KEC. KOTABUMI SELATAN KAB. LAMPUNG UTARA TANGGAL 31 OKTOBER-02 NOVEMBER 2022. Diploma thesis, Poltekkes Kemenkes Tanjungkarang.

LIDIA, ROSA (2023) GAMBARAN FAKTOR EKSTERNAL DARI SISA MAKANAN DI PONDOK PESANTREN DAARUSSA’ADAH PESAWARAN LAMPUNG TAHUN 2023. Diploma thesis, POLTEKKES KEMENKES TANJUNGKARANG.

LIDYA, EKA (2023) UJI EFEKTIVITAS EKSTRAK BUNGA KAMBOJA (Plumeria acuminata) TERHADAP MORTALITAS LARVA NYAMUK Aedes aegypti. Diploma thesis, POLTEKKES KEMENKES TANJUNGKARANG.

LIESTI, EGI AMANDA (2023) ASUHAN KEPERAWATAN GANGGUAN KEBUTUHAN RASA NYAMAN PADA KLIEN HIPERTENSI DI DESA PEMANGGILAN KECAMATAN NATAR LAMPUNG SELATAN TAHUN 2023. Diploma thesis, Poltekkes KemenkesTanjungkarang.

LINGGA, NURDIVA KHAVIVAH (2023) GAMBARAN PENGENDALIAN DBD PADA MASA PANDEMI COVID-19 DI KOTA BANDAR LAMPUNG. Diploma thesis, POLTEKKES KEMENKES TANJUNGKARANG.

LONA, DELVI TREESIA (2023) HUBUNGAN DUKUNGAN KELUARGA DENGAN TINGKAT KECEMASAN PADA PASIEN PRE OPERASI DI RUANG BEDAH RSUD Dr. H. ABDUL MOELOEK PROVINSI LAMPUNG TAHUN 2023. Diploma thesis, Poltekkes KemenkesTanjungkarang.

LUSKINANTI, OLLIN (2023) ASUHAN KEPERAWATAN GANGGUAN KEBUTUHAN AMAN DAN NYAMAN (NYERI) PADA PASIEN DIABETES MELLITUS DI RUANG PENYAKIT DALAM NON INFEKSIUS RSUD Dr.H.ABDUL MOELOEK LAMPUNG TAHUN 2023. Diploma thesis, Poltekkes KemenkesTanjungkarang.

LUTFI, MIA MUSTOFA (2023) ASUHAN KEPERAWATAN DENGAN GANGGUAN OKSIGENASI PADA KASUS STROKE NON HEMORAGIC (SNH) TERHADAP NY. M DI RUANG SARAF RUMAH SAKIT UMUM DAERAH (RSUD) AHMAD YANI METRO TANGGAL 14-16 NOVEMBER 2022. Diploma thesis, Poltekkes Kemenkes Tanjungkarang.

Lestari, Indah (2023) Efektivitas Ekstrak Daun Sirih (Piper Betle, Linn) Sebagai Larvasida Pada Larva Nyamuk Aedes aegypti. Diploma thesis, Poltekkes Kemenkes Tanjung Karang.

Listiani, Novita (2023) ASUHAN KEPERAWATAN GERONTIK DENGAN GANGGUAN KEBUTUHAN RASA NYAMAN PADA KASUS GOUT ARTHRITIS TERHADAP NY. H DI DESA ALAM JAYA WILAYAH KERJA PUSKESMAS KOTABUMI II KABUPATEN LAMPUNG UTARA TANGGAL 11-14 OKTOBER 2022. Diploma thesis, Poltekkes Kemenkes Tanjungkarang.

Lutfiningtias, Lutfiningtias (2023) GAMBARAN ANALISIS BIAYA MAKAN PASIEN PADAPENYELENGGARAANMAKANAN DIRSUD RAGAB BEGAWE CARAM MESUJITAHUN2022. Diploma thesis, POLTEKKES KEMENKES TANJUNGKARANG.

M

MAGRIBI, NAUVAL NUR (2023) FAKTOR PRILAKU MASYARAKAT YANG BERHUBUNGAN DENGAN KEJADIAN DBD DI WILAYAH PUSKESMAS RAJA BASA INDAH KECAMATAN RAJA BASA KOTA BANDAR LAMPUNG TAHUN 2023. Diploma thesis, Poltekkes Tanjungkarang.

MAHARANI, ANGGELA MEYLIA (2023) GAMBARANSTATUSGIZI,PENGGUNAANSUPLEMEN,KEBIASAANMEROKOKDANSOMATOTYPEDENGANVO2MAXPADA ATLETREMAJAWUSHUSABURAILAMPUNGTAHUN2023. Diploma thesis, POLTEKKES KEMENKES TANJUNGKARANG.

MAHARANI, DEAZ (2023) GAMBARAN PELAKSANAAN KESEHATAN DAN KESELAMATAN KERJA (K3) PADA KARYAWAN BAGIAN PRODUKSI DI PERUMDA AIR MINUM WAY RILAU KOTA BANDAR LAMPUNG TAHUN 2023. Diploma thesis, POLTEKKES KEMENKES TANJUNGKARANG.

MAHARANI, DESI PUTRI (2023) GAMBARAN PENGETAHUAN GIZI DAN POLA KONSUMSI IKAN PADA SISWA KELAS X SMA NEGERI 1 PADANG CERMIN TAHUN 2023. Diploma thesis, POLTEKKES KEMENKES TANJUNGKARANG.

MAHARANI, DINI (2023) GAMBARAN PENGGUNAAN OBAT PADA ATLET SEBELUM BERTANDING DI KOTA BANDAR LAMPUNG. Diploma thesis, Poltekkes KemenkesTanjungkarang.

MAHARANI, INDA (2023) ASUHAN KEPERAWATAN POST OPERASI LAPARATOMI PASIEN PERITONITISDALAM MENGATASI NYERI AKUT DENGAN INTERVENSI GUIDED IMAGERY DI RSUD DR. H. ABDUL MOELOEK PROVINSI LAMPUNG TAHUN2023. Diploma thesis, Poltekkes Kemenkes Tanjungkarang.

MAHARANI, INDA (2023) HUBUNGAN MOTIVASI TERHADAP MOBILISASI DINI PADA PASIEN POST OPERASI SEKSIO SESAREA DI RUMAH SAKIT UMUM HANDAYANI KOTABUMI TAHUN 2022. Diploma thesis, Poltekkes Kemenkes Tanjungkarang.

MAHARANI, OLSA (2023) ASUHAN KEPERAWATAN GANGGUAN KEBUTUHAN RASA NYAMAN PADA PASIEN DISPEPSIA DI RUMAH SAKIT BHAYANGKARA POLDA LAMPUNG TAHUN 2023. Diploma thesis, Poltekkes KemenkesTanjungkarang.

MAHARANI, REGITA CISILLIA (2023) EFEK PENINGKATAN KADAR FLAVANOID PADA VARIASI CAMPURAN EKSTRAK DAUN DAN BIJI SIRSAK (Annona muricata.L) SEBAGAI BIOLARVASIDA Aedes aegypti. Diploma thesis, Poltekkes Tanjungkarang.

MAHDALENA, MAHDALENA (2023) ASUHAN KEPERAWATAN GERONTIK DENGAN OKSIGENASI PADA KASUS ASMA TERHADAP TN. A DI DESA TANJUNG AMAN WILAYAH KERJA PUSKESMAS KOTABUMI II TANGGAL 14-16 MARET TAHUN 2023. Diploma thesis, Poltekkes Kemenkes Tanjungkarang.

MAHIRDA, MILNA (2023) HUBUNGAN KONDISI FISIK RUMAH DENGAN PENYAKIT TUBERKULOSIS PARU DI WILAYAH KERJA PUSKESMAS SIMPUR KECAMATAN TANJUNG KARANG KOTA BANDAR LAMPUNG TAHUN 2023. Diploma thesis, Poltekkes Tanjungkarang.

MAHREZA, VENY (2023) FORMULASI DAN EVALUASI SEDIAAN SHAMPO EKSTRAK DAUN KECOMBRANG(Etlingera elatior). Diploma thesis, Poltekkes Tanjungkarang.

MAILENA, MAILENA (2023) HUBUNGAN DUKUNGAN SUAMI DENGAN KESIAPAN IBU PRIMIPARA DALAM MEMBERIKAN ASI EKSKLUSIF POST OPERASI SECTIO CAESAREA DI RSIA MUTIARA PUTRI PROVINSI LAMPUNG TAHUN 2023. Diploma thesis, Poltekkes Kemenkes Tanjungkarang.

MALARDO, MALARDO (2023) GAMBARAN KONDISI RUMAH PENDERITA TB PARU DI WILAYAH KERJA PUSKESMAS RAWAT INAP PANJANG KOTA BANDAR LAMPUNG TAHUN 2023. Diploma thesis, POLTEKKES KEMENKES TANJUNGKARANG.

MANDALA SARTIKA, RECI (2023) PENATALAKSANAAN ASUHAN GIZI TERSTANDAR PADA PASIEN KANKER PAYUDARA DENGAN GAGAL GINJAL KRONIK (GGK) DI RSUD Dr. H.ABDUL MOELOEK PROVINSI LAMPUNG TAHUN 2023. Diploma thesis, POLTEKES KEMENKES TANJUNGKARANG.

MANIK, TANIA CLARISA BR (2023) ASUHAN KEPERAWATAN GERONTIK DENGAN GANGGUAN RASA AMAN NYAMAN PADA KASUS GASTRITIS TERHADAP TN. A DI DESA TANJUNG AMAN KABUPATEN LAMPUNG UTARA TANGGAL 14-16 MARET 2023. Diploma thesis, Poltekkes Kemenkes Tanjungkarang.

MAQFIROH, SEVIA NIHAYATUL (2023) ASUHAN KEBIDANAN PADA IBU HAMIL DENGAN NYERI PUNGGUNG DI TPMB AFRIYANTI LAMBU KIBANG TULANG BAWANG BARAT. Diploma thesis, Poltekkes Tanjungkarang.

MARHANDA, FIRLY (2023) ASUHAN KEPERAWATAN KEBUTUHAN MOBILITAS FISIK PADA KASUS STROKE NON HEMORAGIC TERHADAP Ny.H DI RUMAH SAKIT UMUM HANDAYANI PROVINSI LAMPUNG TANGGAL 20-22 NOVEMBER 2022. Diploma thesis, Poltekkes Kemenkes Tanjungkarang.

MARSELA, CALLISTA (2023) PENERAPAN PEMBERIAN WEDANG JAHE MERAH TERHADAP PENURUNAN INTENSITAS NYERI MENSTRUASI (DISMENORE PRIMER) PADA NN.N DI PMB SRI WINDARTI S.Tr.Keb KAB. LAMPUNG SELATAN. Diploma thesis, Poltekkes Tanjungkarang.

MAULANA, AHMAD ILHAM (2023) PERBANDINGAN HASIL SEDIMEN URIN ANTARA METODE AUTOMATED URINE SEDIMENT ANALYZERDAN METODE MIKROSKOPIS DI RSUD DR. H. ABDUL MOELOEK. Diploma thesis, Poltekkes Kemenkes Tanjungkarang.

MAULIDA, YUNANDA SASSY (2023) PENGARUH LAMA MASA SIMPAN TERHADAP PERUBAHAN KADAR HEMOGLOBIN DAN JUMLAH ERITROSIT PADA WHOLE BLOOD DI UDD PEMBINA PMI PROVINSI LAMPUNG. Diploma thesis, Poltekkes KemenkesTanjungkarang.

MAULIDIANA, KHOIRUNNISA KEN (2023) GAMBARAN HAZARD ANALYSIS CRITICAL CONTROL POINT (HACCP) PADA MENU AYAM BUMBU SATE DAN TAHU KALIO DI RSUD Dr. H. ABDUL MOELOEK TAHUN 2023. Diploma thesis, Poltekkes Kemenkes Tanjungkarang.

MAULINA, FINKA (2023) PENGARUH pH SALIVA SEBELUM DAN SESUDAH MINUM KOPI ROBUSTA PADA MAHASISWA JURUSAN KESEHATAN GIGI POLTEKKES TANJUNGKARANG TAHUN 2023. Diploma thesis, Poltekkes Kemenkes Tanjungkarang.

MAULINA, YUNIKA (2023) ASUHAN KEPERAWATAN PASIEN DENGAN GANGGUAN OKSIGENASI PADA KASUS PNEUMONIA TERHADAP An.R DI RUANG EDELWEIS RSU HANDAYANI KOTABUMI LAMPUNG UTARA TANGGAL 03 – 05 April 2023. Diploma thesis, Poltekkes Kemenkes Tanjungkarang.

MAWADDAH, FADILAH (2023) PENATALAKSANAAN ASUHAN GIZI TERSTANDAR PADA PASIEN GAGAL GINJAL KRONIK DENGAN HEMODIALISIS DI RSUD PRINGSEWU TAHUN 2023. Diploma thesis, POLTEKKES KEMENKES TANJUNGKARANG.

MAWARNI, AYU (2023) HUBUNGAN KONDISI FISIK RUMAH DAN KEPADATAN HUNIAN DENGAN KEJADIAN TB PARU DI WILAYAH PUSKESMAS PERMATA SUKARAME TAHUN 2023. Diploma thesis, Poltekkes Tanjungkarang.

MAYASARI, INTAN (2023) ASUHAN KEPERAWATAN NYERI AKUT PADA PASIEN POST OP MASTEKTOMI DENGAN INTERVENSI AROMATERAPI LAVENDER DI RUMAH SAKIT BHAYANGKARA POLDA LAMPUNG TAHUN 2023. Diploma thesis, Poltekkes Kemenkes Tanjungkarang.

MAYLANDA, SHERLI RUSDINI (2023) GAMBARAN HYGIENE SANITASI RUMAH MAKAN BAGINDO DI KELURAHAN WAY HALIM PERMAI KECAMATAN WAY HALIM KOTA BANDAR LAMPUNG TAHUN 2023. Diploma thesis, POLTEKKES KEMENKES TANJUNGKARANG.

MAYORA, MAHANIDA ANGGALA (2023) GAMBARAN DAYA TERIMA DAN MUTU MAKANAN PASIEN DIABETES MELITUS DI RUANG RAWAT INAP KELAS III RSUD PRINGSEWU TAHUN 2023. Diploma thesis, POLTEKKES KEMENKES TANJUNGKARANG.

MAYSARI, ELDA (2023) PENERAPAN TEKNIK RELAKSASI NAFAS DALAM DAN AROMATERAPI LAVENDER PADA PASIEN POST PROSTATEKTOMI DENGAN MASALAH NYERI AKUT DI RUMAH SAKIT MARDI WALUYO KOTA METRO TAHUN 2023. Diploma thesis, Poltekkes Kemenkes Tanjungkarang.

MEI RENANDA, INES (2023) GAMBARAN TENTANG SISTEM PENGOLAHAN LIMBAH CAIR INDUSTRI TAHU DI DESA BANJAR NEGARA KECAMATAN WONOSOBO KABUPATEN TANGGAMUS TAHUN 2023. Diploma thesis, POLTEKKES KEMENKES TANJUNGKARANG.

MEILIYA, MEILIYA (2023) GAMBARAN ANGKA KUMAN DI UDARA PADA RUMAH PENDERITA TB PARU DI WILAYAH KERJA PUSKESMAS RAWAT INAP KOTA KARANG KOTA BANDAR LAMPUNG TAHUN 2023. Diploma thesis, POLTEKKES KEMENKES TANJUNGKARANG.

MELANIA, LETI KRISTIA (2023) IMPLEMENTASI AROMATERAPI LAVENDER PADA PASIEN DENGAN MASALAH KEPERAWATAN NYERI AKUT POST OPERASI APENDIKTOMIDI RUMAH SAKIT MARDI WALUYO METROTAHUN 2023. Diploma thesis, Poltekkes Kemenkes Tanjungkarang.

MELANIA, LETI KRISTIA (2023) PENGARUH FOOT MASSAGE DAN INHALASI AROMATERAPI LAVENDER TERHADAP PENURUNAN TINGKAT NYERIIBU POST OPERASI SEKSIO SESAREA DI RUANG RAWAT INAP RSUD DR. H. ABDUL MOELOEK PROVINSI LAMPUNG TAHUN 2022. Diploma thesis, Poltekkes Kemenkes Tanjungkarang.

MELATI SARI, LUCY RINDA (2023) GAMBARAN KONDISI RUMAH PADA PENDERITA TB PARU DI PUSKESMAS RAWAT INAP PENENGAHAN KABUPATEN LAMPUNG SELATAN TAHUN 2022. Diploma thesis, POLTEKKES KEMENKES TANJUNGKARANG.

MELIANI, FENI (2023) HUBUNGAN USIA DAN FREKUENSI INDIKASI SC DENGAN LAMA RAWAT INAP PASIEN POST SECTIO CAESAREA DI RSIA RESTU BUNDA KOTA BANDAR LAMPUNG DAN RSUD Dr. H. ABDUL MOELOEK PROVINSI LAMPUNG TAHUN 2023. Diploma thesis, Poltekkes KemenkesTanjungkarang.

MELINDA, NENA (2023) ASUHAN KEPERAWATAN JIWA DENGAN GANGGUAN PEMENUHAN KEBUTUHAN PSIKOSOSIAL HALUSINASI PADA PASIEN SKIZOFRENIA DI RUANG NURI RUMAH SAKIT JIWA DAERAH PROVINSI LAMPUNG TAHUN 2023. Diploma thesis, Poltekkes KemenkesTanjungkarang.

MELINIA, NI MADE (2023) STUDI KASUS PADA PASIEN POST APENDIKTOMI DENGAN INTERVENSI INOVASI TEKNIK RELAKSASI GENGGAM JARI DI RUMAH SAKIT MARDI WALUYO KOTA METROTAHUN 2023. Diploma thesis, Poltekkes Kemenkes Tanjungkarang.

MELIYA, OSA (2023) ASUHAN KEBIDANAN PADA IBU HAMIL DENGAN NYERI PUNGGUNG DI TPMB ERNA SETIYAWATI DI LAMPUNG TIMUR. Diploma thesis, Poltekkes Tanjungkarang.

MERISA, SITI (2023) ASUHAN KEPERAWATAN PASIEN DENGAN GANGGUAN OKSIGENASI PADA KASUS ASMA BRONKIAL TERHADAP Tn. S DI RUANG PARU RUMAH SAKIT DAERAH MAYJEND H.M RYACUDU KOTABUMI TANGGAL 14-16 NOVEMBER 2022. Diploma thesis, Poltekkes Kemenkes Tanjungkarang.

MIRANDA, AYU INDRY (2023) ASUHAN KEPERAWATAN GANGGUAN KEBUTUHAN RASA NYAMAN (NYERI) PADA PASIEN POST OP ABSES PEDIS DI RUMAH SAKIT TK IV 02.07.04 DEKENSYAH 02.04.03 LAMPUNG TAHUN 2023. Diploma thesis, Poltekkes KemenkesTanjungkarang.

MIRANDA, YOSI (2023) GAMBARAN FASILITAS SANITASI DASAR DI DESA BAKHU KECAMATAN BATU KETULIS KABUPATEN LAMPUNG BARAT TAHUN 2023. Diploma thesis, POLTEKKES KEMENKES TANJUNGKARANG.

MONICA, CINTHIA BELLA (2023) HUBUNGAN LAMANYA KONSUMSI OBAT ANTI TUBERCULOSIS (OAT) TERHADAP KADAR ELEKTROLIT PADA PASIEN MULTIDRUG RESISTANT TUBERKULOSIS (MDR-TB) DI RSUD Dr. H. ABDUL MOELOEK PROVINSI LAMPUNG. Diploma thesis, Poltekkes Kemenkes Tanjungkarang.

MUARIFA, AINUN IZZATUL (2023) ANALISIS SARANA PENGELOLAAN SAMPAH DAN ANGKA KEPADATAN LALAT DI PASAR KOTA METRO TAHUN 2023. Diploma thesis, Poltekkes Kemenkes Tanjung Karang.

MUAWANAH, KHOLISATUL (2023) IMPLEMENTASI KOMPRES DINGIN PADAASUHAN KEPERAWATAN NYERI POSTOPERASI HEMOROID DI RUMAH SAKIT MARDI WALUYO KOTA METROTAHUN 2023. Diploma thesis, Poltekkes Kemenkes Tanjungkarang.

MUAWANAH, KHOLISATUL (2023) PENGARUHMOBILISASIDINIDANTERAPIMUSIKTERHADAPINTENSITASNYERIPADA PASIENPOSTOPERASIDIRSUDJENDRAL AHMAD YANI KOTA METROPROVINSILAMPUNGTAHUN2022. Diploma thesis, Poltekkes Kemenkes Tanjungkarang.

MUBAROKAH, NENENG HASANATUN (2023) ASUHAN KEBIDANAN PADA IBU NIFAS DENGAN PUTING SUSU LECET DI PRAKTIK MANDIRI BIDAN OKTARIA ANDRIANI, S.ST TULANG BAWANG BARAT. Diploma thesis, Poltekkes Tanjungkarang.

MUFIDAH, SALWA (2023) PENATALAKSANAAN ASUHAN GIZI TERSTANDAR PADA PASIEN KANKER SERVIKS DENGAN ANEMIA DI RSUD Dr. H ABDUL MOELOEK TAHUN 2023. Diploma thesis, POLTEKKES KEMENKES TANJUNGKARANG.

MUHAMMAD, AGISNI (2023) ASUHAN KEPERAWATAN GANGGUAN RASA AMAN NYAMAN PADA PASIEN PASCA OPERASI TONSILEKTOMI DI RS BHAYANGKARA POLDA LAMPUNG TAHUN 2023. Diploma thesis, Poltekkes KemenkesTanjungkarang.

MUHARROMAH, GITA CELVIA (2023) ASUHAN KEBIDANAN KEHAMILAN DENGAN ANEMIA RINGAN DI TPMB SEPTI YANINGSIH DESA KARYA TANI LABUHAN MARINGGAI LAMPUNG TIMUR. Diploma thesis, Poltekkes Tanjungkarang.

MUKHLISIN, RANDI ARIASTA (2023) ASUHAN KEPERAWATAN PADA PASIEN POSTCRANIOTOMY DENGAN MASALAH KEPERAWATAN GANGGUAN PENYAPIHAN VENTILATOR DI RUANG ICU RSUD DR. H. ABDUL MOELOEK PROVINSI LAMPUNG. Diploma thesis, Poltekkes Kemenkes Tanjungkarang.

MUKHLISIN, RANDI ARIASTA (2023) PENGARUH ACUPRESSURE WRISTBAND DI TITIK NEIGUAN (P6) TERHADAP POST OPERATIVE NAUSEA VOMITING (PONV) PADA PASIEN BEDAH DI RSUD DR. H. ABDUL MOELOEK. Diploma thesis, Poltekkes KemenkesTanjungkarang.

MULIAWIJHAH, ELZA (2023) GAMBARAN KONDISI FISIK RUMAH PADA PENDERITA TUBERKULOSIS PARU DI WILAYAH KERJA PUSKESMAS RAWAT INAP SRAGI KABUPATEN LAMPUNG SELATAN TAHUN 2023. Diploma thesis, POLTEKKES KEMENKES TANJUNGKARANG.

MUNAZIR, RIZKI HANAFI (2023) PENERAPAN FISIOTERAPI DADA TERHADAP PENINGKATAN STATUS OKSIGENASI PADA ANAK DENGAN BRONKOPNEUMONIA DI RUANG E2 (ANAK) RSUD dr. A. DADI TJOKRODIPO KOTA BANDAR LAMPUNG TAHUN 2023. Diploma thesis, Poltekkes KemenkesTanjungkarang.

MURTADHO, DANELLA AMADEA (2023) PENERAPAN MOBILISASI DINI PADA PASIENPOST SECTIOCAESAREA DENGANMASALAH KEPERAWATAN NYERI AKUT DIRUMAH SAKIT BHAYANGKARA POLDA LAMPUNG TAHUN 2023. Diploma thesis, Poltekkes Kemenkes Tanjungkarang.

MUSYAFFA, M. ABDUH (2023) PERBEDAAN LAMA HARI RAWAT PASIEN SECTIO CAESAREA MENGGUNAKAN METODE ENHANCED RECOVERY AFTER CAESARIAN SURGERY (ERACS) DENGAN SECTIO CAESAREA KONVENSIONAL DI RUMAH SAKIT PROVINSI LAMPUNG TAHUN 2023. Diploma thesis, Poltekkes Kemenkes Tanjungkarang.

MUTHIA WAHYUDI, FA’IZA (2023) ASUHAN KEBIDANAN PADA IBU BERSALIN KALA I FASE AKTIF DENGAN PENGURANGAN NYERI PERSALINAN PENGGUNAAN BIRTH BALL EXERCISE DI TPMB NURUL MARFU’AH. Diploma thesis, Poltekkes Tanjungkarang.

MUTIARA, DENITA (2023) UJI EFEKTIVITAS EKSTRAK DAUN JERUK NIPIS (Citrus aurantifolia) DALAM MEMBUNUH LARVA NYAMUK AEDES AEGYPTI TAHUN 2023. Diploma thesis, POLTEKKES KEMENKES TANJUNGKARANG.

MUTIARA, DINDA (2023) PEMANFAATAN LIMBAH SERBUK GERGAJI DAN LIMBAH PERTANIAN PISANG MENJADI BRIKET. Diploma thesis, POLTEKKES KEMENKES TANJUNGKARANG.

MUTIARA, NOER TASYA (2023) GAMBARAN HIV-1 RNA VIRAL LOAD PADA PASIEN HIV/AIDS YANG MENJALANI PENGOBATAN ARV di RSUD Dr. H. ABDUL MOELOEK. Diploma thesis, Poltekkes KemenkesTanjungkarang.

MYLANDA, DHEA FEBRULIZA (2023) ASUHAN KEPERAWATAN PADA PASIEN CEPHALGIA DENGAN NYERI AKUT DI RUANG MELATI RUMAH SAKIT DKT DENKESYAH LAMPUNG TAHUN 2023. Diploma thesis, Poltekkes KemenkesTanjungkarang.

Meliana, Septi Dewi (2023) GAMBARAN PENGETAHUAN DAN SIKAP MAHASISWA PRODI D III TEKNIK GIGI DALAM PENGGUNAAN ALAT PELINDUNG DIRI PADA PRAKTIKUM CASTING LOGAM DI LABORATORIUM TEKNIK GIGI. Diploma thesis, Poltekkes KemenkesTanjungkarang.

N

N, SEPTINA INDRI (2023) PENGARUH METODE PEMICUAN TERHADAP PERILAKU BUANG AIR BESAR SEMBARANGAN PADA MASYARAKAT DI DESA BATU NANGKOP KECAMATAN SUNGKAI TENGAH TAHUN 2023. Diploma thesis, Poltekkes Tanjungkarang.

NABILA, ALYA (2023) PENERAPAN TERAPI RELAKSASI OTOT PROGRESIF TERHADAP KECEMASAN PASIENPRE SECTIO CAESAREA DI RS BHAYANGKARA POLDA LAMPUNG TAHUN 2023. Diploma thesis, Poltekkes Kemenkes Tanjungkarang.

NABILA, PUTRI (2023) GAMBARAN HYGIENE SANITASI MAKANAN DI RUMAH SAKIT ISLAM KOTA METRO TAHUN 2022. Diploma thesis, Poltekkes Tanjungkarang.

NABILAH, LAILA ARIFAH (2023) ASUHAN KEPERAWATAN GANGGUAN PEMENUHAN KEBUTUHAN OKSIGENASI PADA NY. H DENGAN TUBERKULOSIS PARU DI RUANG PARU RUMAH SAKIT UMUM MAYJEND H.M. RYACUDU KOTABUMI TANGGAL 09 - 11 NOVEMBER 2022. Diploma thesis, Poltekkes Kemenkes Tanjungkarang.

NABILLA, SHINTA (2023) GAMBARAN HIGIENE SANITASI TEMPAT DAN PERALATAN MAKAN, SIKAP SERTA PERILAKU HIGIENE SANITASI PENGOLAH DAN PENDISTRIBUSIAN MAKANAN DI RUMAH SAKIT BHAYANGKARA BANDAR LAMPUNG TAHUN 2023. Diploma thesis, POLTEKKES KEMENKES TANJUNGKARANG.

NABILLA, ZAHRA (2023) ASUHAN KEBIDANAN PADA BAYI BARU LAHIR DENGAN IKTERUS DI TEMPAT PRAKTIK MANDIRI BIDAN DERINA ARISYAH DI TIYUH PENUMANGAN BARU KABUPATEN TULANG BAWANG BARAT. Diploma thesis, Poltekkes Tanjungkarang.

NADIYA FLORENTINE, KOMANG (2023) GAMBARAN LINGKUNGAN FISIK RUMAH DENGAN KEJADIAN TB PARU DI WILAYAH KERJA UPTD PUSKESMAS BANDAR AGUNG KECAMATAN TERUSAN NUNYAI KABUPATEN LAMPUNG TENGAH TAHUN 2023. Diploma thesis, POLTEKKES KEMENKES TANJUNGKARANG.

NAFISA, NURUL (2023) ASUHAN KEPERAWATAN PASIEN DENGAN GANGGUAN SIRKULASI PADA KASUS ANEMIA TERHADAP NY. I DI RUANG FRESIA LANTAI 4 RUMAH SAKIT UMUM HANDAYANI KOTABUMI LAMPUNG UTARA TANGGAL 09-11 NOVEMBER 2022. Diploma thesis, Poltekkes Kemenkes Tanjungkarang.

NAILISSA’ADAH, ADELIANA (2023) GAMBARAN STANDAR RUMAH SEHAT PADA PENDERITA INFEKSI SALURAN PERNAFASAN AKUT (ISPA) DI WILAYAH KERJA PUSKESMAS BERNUNG KECAMATAN GEDONG TATAAN TAHUN 2023. Diploma thesis, POLTEKKES KEMENKES TANJUNGKARANG.

NAJARINA, ELSA (2023) ASUHAN KEBIDANAN PADA BAYI DENGAN KETERLAMBATAN TUMBUH KEMBANG PADA ASPEK MOTORIK KASAR MERAGUKAN DI TPMB LELY DESA RAJABASA LAMA KECAMATAN LABUHAN RATU LAMPUNG TIMUR. Diploma thesis, Poltekkes Tanjungkarang.

NANDA, GUSTIA MEGA (2023) HUBUNGAN PERILAKU CARING PERAWAT DENGAN PENERAPAN STANDAR KESELAMATAN PASIEN (PENGURANGAN RISIKO INFEKSI) PADA PASIEN PERIOPERATIF DI RUANG BEDAH RUMAH SAKIT UMUM DAERAH Dr. H. ABDUL MOELOEK PROVINSI LAMPUNG. Diploma thesis, Poltekkes KemenkesTanjungkarang.

NANDA RHAMADAN, DICKY (2023) KEMAMPUAN EKSTRAK DAUN PEPAYA (Caricca papaya Linn) TERHADAP MORTALITAS LARVA NYAMUK Aedes aegypti. Diploma thesis, POLTEKKES KEMENKES TANJUNGKARANG.

NANDAVANIA, FHADILA (2023) FAKTOR-FAKTOR LINGKUNGAN YANG BERHUBUNGAN DENGAN KEJADIAN TB PARU DI WILAYAH KERJA PUSKESMAS LEMONG TAHUN 2023. Diploma thesis, Poltekkes Tanjungkarang.

NAOMI, MIRANDA (2023) GAMBARAN SARANA SANITASI RUMAH PENDERITA DIARE DI WILAYAH KERJA PUSKESMAS RAWAT INAP SIMPUR KOTA BANDAR LAMPUNG TAHUN 2023. Diploma thesis, POLTEKKES KEMENKES TANJUNGKARANG.

NEBESSKI, DZAKARA (2023) EFEKTIVITAS EKSTRAK DAUN BINAHONG( Anredera cordifolia ) SEBAGAI BIOLARVASIDA PADA LARVA Aedes aegypti INSTAR III. Diploma thesis, Poltekkes Kemenkes Tanjung Karang.

NESA PRAMESTI MZ, MUTIARA (2023) PENATALAKSANAAN NYERI PADA PASIEN LOW BACK PAIN DAN POST OPERASI HERNIA INGUINALIS LATERAL DI RUANG BEDAH RUMAH SAKIT DR. A. DADI TJOKRODIPO KOTA BANDAR LAMPUNG TAHUN 2023. Diploma thesis, Poltekkes KemenkesTanjungkarang.

NINGRUM, KARTIKA PUSPITA (2023) ASUHAN KEBIDANAN PADA AKSEPTOR SUNTIK 1 BULAN DENGAN HEMMORHAGIE DI TPMB ARYATI SUMARLINDA MARGA ASRI TULANG BAWANG BARAT. Diploma thesis, Poltekkes Tanjungkarang.

NINGSIH, NINGSIH (2023) ASUHAN KEPERAWATAN GANGGUAN CITRA TUBUH PADAPASIEN POST MASTEKTOMIDENGAN INTERVENSI PROMOSI KOPINGDI RSBHAYANGKARA POLDALAMPUNG TAHUN 2023. Diploma thesis, Poltekkes Kemenkes Tanjungkarang.

NINGSIH, SELVI WIDYA (2023) PENATALAKSANAAN INFEKSI SILANG TERHADAP PENULARAN PENYAKIT PADA MAHASISWA/I KESEHATAN GIGI POLTEKKES TANJUNGKARANG DI TINGKAT 2 TAHUN 2023. Diploma thesis, Poltekkes Kemenkes Tanjungkarang.

NINGTYAS, PUTRI PUSPA (2023) GAMBARAN KONDISI HYGIENE SANITASI RUMAH MAKAN DI KECAMATAN LABUHAN RATU KOTA BANDAR LAMPUNG TAHUN 2023. Diploma thesis, POLTEKKES KEMENKES TANJUNGKARANG.

NIRWANI, NIRWANI (2023) IMPLEMENTASITHERAPIRELAKSASIAUTOGENIK DALAMMENGATASINYERIAKUTPADAPASIENCHRONICKIDNEYDISEASE(CKD) DENGAN TINDAKAN OPERASI INSERSI CATHETER TENCKHOFFDIRUANGBEDAHRSUDdrHiABDULMOELOEK PROVINSI LAMPUNGTAHUN 2023. Diploma thesis, Poltekkes Kemenkes Tanjungkarang.

NISA, FIRZA NOVIATUN (2023) STUDI KASUS PADA PASIEN POST DEBRIDEMENT ULKUS DIABETIKUM DENGAN INTERVENSI INOVASI PERAWATAN LUKA MOIST WOUND HEALING DI RUMAH SAKIT MARDI WALUYO KOTA METRO TAHUN 2023. Diploma thesis, Poltekkes Kemenkes Tanjungkarang.

NISA, ISTHY KHOIRUN (2023) EFEKTIVITAS EKSTRAK DAUN MENGKUDU (Morinda Citrifolia L) SEBAGAI LARVASIDA TERHADAP LARVA NYAMUK Aedes Aegypti. Diploma thesis, Poltekkes Kemenkes Tanjung Karang.

NOFIYANI, VERONICA RISDA (2023) GAMBARAN KARAKTERISTIK, ASUPAN ZATGIZI DAN STATUS GIZI PASIEN GAGAL GINJAL KRONIKDENGAN HEMODIALISIS DI POLI RAWAT JALAN RSUD ALIMUDDIN UMAR LAMPUNG BARAT TAHUN 2023. Diploma thesis, POLTEKKES KEMENKES TANJUNGKARANG.

NOVELA, ANGGIA (2023) GAMBARAN TINGKAT PENGETAHUAN GIZI AKTIVITAS FISIK DAN STATUS GIZI REMAJA PUTRI SMA IT BAITUL JANNAH ISLAMIC SCHOOL TAHUN 2023. Diploma thesis, POLTEKKES KEMENKES TANJUNGKARANG.

NOVITA, CANTIKA DIAN (2023) GAMBARAN HASIL PEMERIKSAAN INFEKSI MENULAR SEKSUAL PADA CALON TENAGA KERJA INDONESIA (CTKI) DI KLINIK UTAMA ASSALAM MEDICAL CENTER TAHUN 2022. Diploma thesis, Poltekkes KemenkesTanjungkarang.

NOVITA, XANTIA (2023) LATIHANANKLE PUMPUNTUK MENGATASI MASALAH KEPERAWATAN NYERI AKUT PADA PASIEN POST OP TOTAL HIP REPLACEMENT e.cOSTEROARTHRITIS DI RUANG BEDAH RSUD DR HI ABDUL MOELOEK PROVINSI LAMPUNG. Diploma thesis, Poltekkes Kemenkes Tanjungkarang.

NOVITASARI, INTAN (2023) HUBUNGAN DERAJAT KEPOSITIFAN BASIL TAHAN ASAM (BTA) TERHADAP ENZIM SERUM GLUTAMAT OKSALOASETAT TRANSAMINASE (SGOT) DAN SERUM GLUTAMAT PIRUVAT TRANSAMINASE (SGPT) PADA PASIEN TUBERKULOSIS YANG MENGKONSUMSI OBAT ANTI TUBERKULOSIS (OAT). Diploma thesis, Poltekkes KemenkesTanjungkarang.

NOVITASARI, NOVITASARI (2023) ASUHAN KEPERAWATAN PASIEN DENGAN GANGGUAN NUTRISI DAN CAIRAN PADA KASUS HIPEREMESIS GRAVIDARUM TERHADAP Ny. I Di RUANG KEBIDANAN RSU HANDAYANI KOTABUMI LAMPUNG UTARA TANGGAL 31 MARET-02APRIL 2023. Diploma thesis, Poltekkes Kemenkes Tanjungkarang.

NOVRIANI, RATNA AULIA N (2023) ANALISIS HIGIENE SANITASI MAKANAN DAN PENERAPAN PRINSIP HAZARD ANALYSIS AND CRITICAL CONTROL POINT (HACCP) PADA PENGOLAHAN MAKANAN DI RUMAH SAKIT UMUM DAERAH ALIMUDDIN UMAR KABUPATEN LAMPUNG BARAT TAHUN 2023. Diploma thesis, Poltekkes Tanjungkarang.

NUR AZIZAH, LUTHFI (2023) PENERAPAN PRENATAL YOGA TERHADAP PENURUNAN NYERI PUNGGUNG PADA IBU HAMILTRIMESTER III PADA NY.T DI PMB SRI WINDARTI S.TR.KEB LAMPUNG SELATAN. Diploma thesis, Poltekkes Kemenkes Tanjungkarang.

NUR ROHMAH, LIA WINDI (2023) GAMBARAN SANITASI LINGKUNGAN RUMAH PADA BALITA PENDERITA STUNTING DI WILAYAH KERJA PUSKESMAS RAWAT INAP TANJUNG RAJA KABUPATEN LAMPUNG UTARA TAHUN 2023. Diploma thesis, POLTEKKES KEMENKES TANJUNGKARANG.

NUR SAFITRI, AZZAHRA (2023) ASUHAN KEPERAWATAN GANGGUAN KEBUTUHAN RASA NYAMAN (NYERI) PADA PASIEN POST OPERASI HERNIA INGUINALIS DI RUMAH SAKIT TK IV DENKENSYAH LAMPUNG TAHUN 2023. Diploma thesis, Poltekkes KemenkesTanjungkarang.

NURASIH, CUCUM (2023) ASUHAN KEPERAWATAN DENGAN GANGGUAN PEMENUHAN KEBUTUHAN RASA NYAMAN; NYERI DAN KENYAMANAN PADA PASIEN HIPERTENSI DESA SRIMULYO 1 NATAR LAMPUNG SELATAN TAHUN 2023. Diploma thesis, Poltekkes KemenkesTanjungkarang.

NURFAIZAH, DIAN (2023) PENERAPAN PERMAINAN PUZZEL ANGKA TERHADAP PERKEMBANGAN BAHASA PADA AN.A DI BANDAR LAMPUNG. Diploma thesis, Poltekkes Kemenkes Tanjungkarang.

NURHALIZA, FADILA (2023) GAMBARAN PENGETAHUAN DAN PERILAKU TENAGA PENGOLAH MAKANAN TERHADAP HIGIENE DAN SANITASI PENYELENGGARAN MAKANAN DI INSTALASI GIZI RSUD SUKADANA TAHUN 2023. Diploma thesis, POLTEKKES KEMENKES TANJUNGKARANG.

NURHASANAH, NURHASANAH (2023) EVALUASI PENGELOLAAN LIMBAH PADAT MEDIS DENGAN SISTEM 3R (REDUCE, REUSE, RECYCLE) DI RSUD JEND. A. YANI METRO TAHUN 2021. Diploma thesis, Poltekkes Tanjungkarang.

NURHASANAH, QURROTA A’YUN (2023) PENGARUH KOMBINASI KOMPRES HANGAT DAN AFIRMASI POSITIF TERHADAP PENGELUARAN KOLOSTRUM PADA PASIEN POST OPERASI SECTIO CAESAREA DI RSIA ANUGERAH MEDICAL CENTRE KOTA METRO TAHUN 2023. Diploma thesis, Poltekkes Kemenkes Tanjungkarang.

NURHASANAH, SELI (2023) ASUHAN KEBIDANAN PERSALINAN DI TPMB KISWARI KOTA METRO. Diploma thesis, Poltekkes Tanjungkarang.

NURHIDAYATI, NOVA DWI (2023) GAMBARAN ASUPAN GIZI, STATUS GIZI DAN KADAR ASAM URAT PADA PENDERITA HIPERURISEMIA DI WILAYAH KERJA PUSKESMAS BULOK TAHUN 2023. Diploma thesis, POLTEKKES KEMENKES TANJUNGKARANG.

NURIYAWATI, JANA (2023) ASUHAN KEPERAWATAN PADA PASIEN DENGAN GANGGUAN PERSEPSI SENSORI: HALUSINASI PENDENGARAN PADA KASUS SKIZOFRENIA PARANOID TERHADAP NY. S DI RUANG MELATI RUMAH SAKIT JIWA DAERAH PROVINSI LAMPUNG TANGGAL 21 s.d. 23 MARET 2022. Diploma thesis, Poltekkes Kemenkes Tanjungkarang.

NURJAYANTI, SRI (2023) EFEKTIVITAS KOMPRES HANGAT UNTUK MENGURANGI RASA NYERI PADA IBU BERSALIN KALA I FASE AKTIF DI PMB SANTI YUNIARTI, S.Tr.,Keb LAMPUNG SELATAN. Diploma thesis, Poltekkes Kemenkes Tanjungkarang.

NURJAYANTI, SRI (2023) EFEKTIVITAS KOMPRES HANGAT UNTUK MENGURANGI RASA NYERI PADA IBU BERSALIN KALA I FASE AKTIF DI PMB SANTI YUNIARTI, S.Tr.,Keb LAMPUNG SELATAN. Diploma thesis, Poltekkes Kemenkes Tanjungkarang.

NURMALA, DESFITRIA (2023) GAMBARAN KEPUASAN PASIEN RAWAT INAP KELAS III TERHADAP PENYAJIAN DAN VARIASI MENU MAKANAN LUNAK DI RSUD Dr. H. ABDUL MOELOEK PROVINSI LAMPUNG. Diploma thesis, Poltekkes KemenkesTanjungkarang.

NURMALA, DEVIA SALUM (2023) PENERAPAN TEKNIK MASSASE EFFLEURAGE DALAM UPAYA MEMPERCEPAT PROSES INVOLUSI UTERUS PADA NY.A P2AO DI PMB KARMILA ASTUTI, SST LAMPUNG SELATAN. Diploma thesis, Poltekkes Tanjungkarang.

NURUL HIDAYAH, SABINA (2023) USAP ALAT MAKAN DI RUMAH MAKAN PUTI MINANG HAJIMENA TAHUN 2023. Diploma thesis, POLTEKKES KEMENKES TANJUNGKARANG.

NURUL PRATIWI, APRILIYANA (2023) GAMBARAN FAKTOR-FAKTOR SANITASI KOLAM RENANG DI KECAMATAN GISTING KABUPATEN TANGGAMUS TAHUN 2023. Diploma thesis, POLTEKKES KEMENKES TANJUNGKARANG.

NURWATI, DORO (2023) EFEKTIVITAS PENGGUNAAN SIKAT GIGI DEWASA DAN SIKAT GIGI ANAK-ANAK TERHADAP PENURUNAN NILAI DEBRIS INDEKS PADA SISWA KELAS V SD N 1 LABUHAN RATU TAHUN 2023. Diploma thesis, Poltekkes Kemenkes Tanjungkarang.

NUR’AINI, SITI (2023) HUBUNGAN KADAR KOLESTEROL TOTAL DENGAN TEKANAN DARAH PADA PASIEN DM TIPE 2 CLUB PROLANIS DI PUSKESMAS RAWAT INAP SUKABUMI. Diploma thesis, Poltekkes Kemenkes Tanjungkarang.

NUZULIAH, HIKMATIN (2023) ASUHAN KEPERAWATAN GANGGUAN KEBUTUHAN AMAN NYAMAN PADA PASIEN TYPHOID DIKELAS 2-3 RUMAH SAKIT BHAYANGKARA POLDA LAMPUNG TAHUN 2023. Diploma thesis, Poltekkes KemenkesTanjungkarang.

Nabilah, Nada (2023) GAMBARAN ASUPAN PURIN, VITAMIN C, DAN CAIRAN PENDERITA HIPERURISEMIA DI WILAYAH KERJA PUSKESMAS RAWAT INAP SUKABUMI BANDAR LAMPUNG TAHUN 2023. Diploma thesis, POLTEKKES KEMENKES TANJUNGKARANG.

Nugroho, Bimantara (2023) PEMBUATAN GIGI TIRUAN SEBAGIAN LEPASAN AKRILIK PADA BENTUK LINGGIR YANG BERBEDA. Diploma thesis, Poltekkes KemenkesTanjungkarang.

O

OKCIANA, INDAH (2023) IMPLEMENTASI KEPERAWATAN TEKNIK RELAKSASI AROMATERAPI LAVENDER PADA PASIEN POST HEMOROIDEKTOMI DENGAN NYERI AKUT DI RSUD JENDERAL AHMAD YANI KOTA METRO TAHUN 2023. Diploma thesis, Poltekkes Kemenkes Tanjungkarang.

OKTARIA, CINDI (2023) GAMBARAN SANITASI PASAR TRADISIONAL DI KOTA BANDAR LAMPUNG TAHUN 2022. Diploma thesis, Poltekkes Tanjungkarang.

OKTARIA, VYONA (2023) PENERAPAN BIRTHING BALL UNTUK MENGURANGI NYERI PADA IBU BERSALIN KALA 1 TERHADAP NY.D DI PMB JILLY PUNNICA A.Md.Keb. Diploma thesis, Poltekkes Kemenkes Tanjungkarang.

OKTARIANA, RESI (2023) GAMBARAN KONDISI FISIK RUMAH BALITA PENDERITA ISPA DI WILAYAH KERJA PUSKESMAS RAWAT INAP KEMILING KOTA BANDAR LAMPUNG TAHUN 2022. Diploma thesis, Poltekkes Tanjungkarang.

OKTAVIA, BERLIANA (2023) FAKTOR-FAKTOR YANG BERHUBUNGAN DENGAN KELANCARAN ASI PADA IBU POST SEKSIO SESAREA DI RSIA ANUGERAH MEDICAL CENTER PROVINSI LAMPUNG TAHUN 2023. Diploma thesis, Poltekkes Kemenkes Tanjungkarang.

OKTAVIA, ERIKA (2023) GAMBARAN FAKTOR LINGKUNGAN DAN PERILAKU MASYARAKAT BERKAITAN DENGAN KEJADIAN DEMAM BERDARAH DENGUE (DBD) DI PEKON MARGAKAYA KABUPATEN PRINGSEWU TAHUN 2023. Diploma thesis, POLTEKKES KEMENKES TANJUNGKARANG.

OKTAVIA, WIDIA (2023) HUBUNGAN SANITASI LINGKUNGAN DAN HIGIENE PERORANGAN DENGAN KASUS DEMAM TIFOID DI WILAYAH KERJA PUSKESMAS TANJUNGSARI KECAMATAN NATAR TAHUN 2023. Diploma thesis, Poltekkes Tanjungkarang.

OKTAVIANA, OKTAVIANA (2023) ASUHAN KEPERAWATAN NYERI AKUT PADA PASIEN POST APPENDIKTOMI DENGAN APLIKASI TERAPI MUROTTAL AL-QUR’AN DI RUMAH SAKIT BHAYANGKARA BANDAR LAMPUNG TAHUN 2023. Diploma thesis, Poltekkes Kemenkes Tanjungkarang.

OKTAVIANA, RARA (2023) ASUHAN KEPERAWATAN GANGGUAN KEBUTUHAN NUTRISI PADA PASIEN DENGAN DIABETES MELITUS DI RUANG PENYAKIT DALAM RSUD A. DADI TJOKRODIPO BANDAR LAMPUNG TAHUN 2023. Diploma thesis, Poltekkes KemenkesTanjungkarang.

OKTAVIANI, RISKA (2023) ASUHAN KEPERAWATAN GANGGUAN KEBUTUHAN ISTIRAHAT DAN TIDUR PADA KLIEN HIPERTENSI DI DUSUN SRIMULYO 1 DESA PEMANGGILAN KECAMATAN NATAR LAMPUNG SELATAN TAHUN 2023. Diploma thesis, Poltekkes KemenkesTanjungkarang.

OKTAVIYANI, DWI EKA (2023) PENGARUH PEMBERIAN SUSU KEDELAI TERHADAP NY.R UNTUK PENINGKATAN PRODUKSI ASI DI PMB REDINSE SITORUS LAMPUNG SELATAN. Diploma thesis, Poltekkes Kemenkes Tanjungkarang.

OLIVIA, VITTA (2023) ANALISIS FAKTOR YANG BERHUBUNGAN DENGANKEJADIANKARIESGIGIPADAANAKPRASEKOLAHDITKAL-HAIRIAHBANDARLAMPUNGTAHUN2023. Diploma thesis, Poltekkes Kemenkes Tanjungkarang.

OPERASETIYA, EU NIKE (2023) HUBUNGAN KOMUNIKASI TERAPEUTIK PERAWAT DENGAN PENURUNAN TINGKAT KECEMASAN PASIEN PRE OPERASI DI RUMAH SAKIT MARDI WALUYO KOTA METRO TAHUN 2023. Diploma thesis, Poltekkes KemenkesTanjungkarang.

Oktavia Saputri, Anisya (2023) PENERAPAN TEKNIK PIJAT LAKTASI DALAM UPAYA MEMPERLANCAR PENGELUARAN ASI PADA IBU POST PARTUM TERHADAP NY.M P1A0 DI PMB ANNISAK MEISURI,S.ST. Diploma thesis, Poltekkes Kemenkes Tanjungkarang.

Ovilia, Dhea (2023) GAMBARAN PENGETAHUAN TENTANG GIZI SEIMBANG, STATUS GIZI DAN ASUPAN MAKAN REMAJA PUTRI DI PONDOK PESANTREN SUNANULHUDA KABUPATEN LAMPUNG SELATAN TAHUN 2023. Diploma thesis, POLTEKKES KEMENKES TANJUNGKARANG.

P

PALUPI, VINNY TIAS (2023) KORELASIKADAR MIKROALBUMINURIADENGANKADARUREUM DARAH PADA PASIEN DIABETESMELITUSDI LABORATORIUM KLINIK PRAMITRA BIOLAB BANDAR LAMPUNG. Diploma thesis, Poltekkes Kemenkes Tanjungkarang.

PAMUNGKAS, LINGGA CATUR (2023) PENGARUH EKSTRAK AIR DAUN KOPI ARABIKA(Coffea arabica) TERHADAP MORTALITAS LARVA NYAMUK Aedes aegypti. Diploma thesis, Poltekkes KemenkesTanjungkarang.

PANDWI, SANOVAL AJI (2023) PENGARUH TEKNIK HIPNOSIS LIMA JARI TERHADAP KECEMASAN PADA PASIEN PRE OPERASI SEKSIO SESAREA DI RSIA ANUGERAH MEDIKAL CENTER METRO LAMPUNG TAHUN 2023. Diploma thesis, Poltekkes KemenkesTanjungkarang.

PANGESTU, SYAHRIZAL DWI (2023) GAMBARAN TINGKAT KEBISINGAN DI LINGKUNGAN PEMUKIMAN SEKITAR REL KERETA API KELURAHAN LABUHAN RATU RAYA KECAMATAN LABUHAN RATU KOTA BANDAR LAMPUNG TAHUN 202. Diploma thesis, POLTEKKES KEMENKES TANJUNGKARANG.

PARAMESTI, NI MADE REGITA (2023) GAMBARAN SANITASI DASAR PENDERITA PENYAKIT DIARE DI DESA LEBUH DALEM WILAYAH KERJA PUSKESMAS LEBUH DALEM. Diploma thesis, Poltekkes Tanjungkarang.

PARAMITA.S, YESICA (2023) ASUHAN KEPERAWATAN GAWAT DARURAT GANGGUAN KEBUTUHAN OKSIGENASI PADA TN.S DENGAN KASUS PNEUMONIA DI INSTALASI GAWAT DARURAT RSU HANDAYANI KOTABUMI TANGGAL 26 NOVEMBER 2022. Diploma thesis, Poltekkes Kemenkes Tanjungkarang.

PARAMITHA, SONIA (2023) PENGARUH PEMBERIAN TERAPI MUSIK MOZART TERHADAP PENURUNAN SKALA NYERI PADA PASIEN POST OPERASI LAPARATOMI DIRSUD.DR.H.ABDUL MOELOEK PROVINSI LAMPUNG TAHUN 2023. Diploma thesis, Poltekkes KemenkesTanjungkarang.

PERMATA, NICA MAHARANI LIDIA (2023) HUBUNGAN INDEKS MASSA TUBUH (IMT) DAN LAMAOPERASI TERHADAP POST ANESTHETIC SHIVERING (PAS) PADA PASIEN DENGAN ANESTESI SPINAL DI RSUD Dr. H. ABDUL MOELOEK TAHUN 2023. Diploma thesis, Poltekkes Kemenkes Tanjungkarang.

PERMATA SARI, SEVIRA (2023) GAMBARAN KARAKTERISTIK,KONDISI FISIK RUMAH,DAN PERILAKU KEBIASAAN MEROKOK PADA PENDERITA TB PARU DI WILAYAH KERJA PUSKESMAS SUKADANA KABUPATEN LAMPUNG TIMUR TAHUN 2023. Diploma thesis, POLTEKKES KEMENKES TANJUNGKARANG.

PERSADA, VERA ROSA (2023) ASUHAN KEPERAWATAN DENGAN GANGGUAN OKSIGENASI PADA KASUS PNEUMONIA TERHADAP TN. S DI RUANG FREESIA RS HANDAYANI KOTABUMI LAMPUNG UTARA TANGGAL 14-16 NOVEMBER 2022. Diploma thesis, Poltekkes Kemenkes Tanjungkarang.

PERSATIKA, TRYA NADA (2023) GAMBARAN KANDUNGAN FORMALIN PADA BUAH APEL YANG DI JUAL DI PASAR GINTUNG TANJUNG KARANG KOTA BANDAR LAMPUNG TAHUN 2023. Diploma thesis, Poltekkes KemenkesTanjungkarang.

PERTIWI, OKTIA HANI (2023) ASUHAN KEPERAWATAN PADA PASIEN POST DEBRIDEMEN ULKUS DIABETIKUM DENGAN MASALAH KEPERAWATAN NYERI AKUT DI RSUD AHMAD YANI KOTA METRO TAHUN 2023. Diploma thesis, Poltekkes Kemenkes Tanjungkarang.

PIRMANDA SR, REPKA (2023) ASUHAN KEPERAWATAN GANGGUAN KEBUTUHAN RASA NYAMAN PADA KLIEN HIPERTENSI DI DUSUN SRIMULYO 1 DESA PEMANGGILAN KECAMATAN NATAR KABUPATEN LAMPUNG SELATAN TAHUN 2023. Diploma thesis, Poltekkes KemenkesTanjungkarang.

PITALOKA, MUSTIKA AYU (2023) HUBUNGAN PENDAMPINGAN ORANG TUA DENGAN STRES HOSPITALISASI ANAK PRE OPERASI DI RUANG BEDAH RSUD DR. H. ABDUL MOELOEK PROVINSI LAMPUNG TAHUN 2023. Diploma thesis, Poltekkes Kemenkes Tanjungkarang.

PRADANA, KELVIN YUGO (2023) DESAIN RANCANG BANGUNAN PENGOLAHAN AIR TIPE INJECTION PORTABLE DALAM RANGKA PEMENUHAN AIR BERSIH PADA KONDISI BENCANA. Diploma thesis, POLTEKKES KEMENKES TANJUNGKARANG.

PRADNYAWATI, NI PUTU WINDA DIAH (2023) PENGARUH PEMANASAN PADA PROSES FIKSASI JARINGAN KANKER PAYUDARA TERHADAP KUALITAS SEDIAAN DENGAN PEWARNAAN HEMATOXYLIN EOSIN DI LABORATORIUM PATOLOGI ANATOMI NADAFRI. Diploma thesis, Poltekkes Kemenkes Tanjungkarang.

PRAMESTI, AZARINE WIDYA (2023) DAYA TERIMA COOKIES DENGAN PENAMBAHAN TEPUNG TEMPE DAN TEPUNG BAYAM HIJAU SEBAGAI MAKANAN SELINGAN TINGGI ZAT BESI UNTUK REMAJA PUTRI TAHUN 2023. Diploma thesis, Poltekkes KemenkesTanjungkarang.

PRAMUDITA, HERLINDA AYU (2023) ASUHAN KEPERAWATAN DENGAN GANGGUAN KEBUTUHAN CAIRAN DAN ELEKTROLIT PADA KASUS CKD TERHADAP TN. R DI RUANG PENYAKIT DALAM A RSUD JENDRAL AHMAD YANI METRO TANGGAL 31 OKTOBER-05 NOVEMBER 2022. Diploma thesis, Poltekkes Kemenkes Tanjungkarang.

PRAMUDITA, YOCY EFRIZA (2023) HUBUNGAN SANITASI LINGKUNGAN DAN PERSONAL HYGIENE DENGAN KEJADIAN DERMATITIS KONTAK DIWILAYAH KERJA UPT PUSKESMAS SIMPUR KOTA BANDAR LAMPUNG TAHUN 2023. Diploma thesis, Poltekkes Kemenkes Tanjung Karang.

PRAMUJA, ELGA ADJENG (2023) EFEKTIVITASBERKUMURAIRREBUSANDAUNJAMBUBIJI DANAIRREBUSANDAUNSALAMTERHADAPPENURUNAN SCOREPLAKPADAANAKKELASIII-IVSDN2AIRKUBANG TAHUN2023. Diploma thesis, Poltekkes Kemenkes Tanjungkarang.

PRAMUTSU, ARYA TEJA (2023) ASUHAN KEPERAWATAN DENGAN GANGGUAN KEBUTUHAN OKSIGENASI PADA KASUS CEDERA KEPALA BERAT TERHADAP TN. A DI RUANG INSTALASI GAWAT DARURAT RSUD JENDRAL AHMAD YANI METRO LAMPUNG TANGGAL 08 NOVEMBER 2022. Diploma thesis, Poltekkes Kemenkes Tanjungkarang.

PRANSISKA, RINA (2023) PENGARUH MENGUNYAH BUAH SEMANGKA TERHADAP PENURUNAN INDEKS PLAK PADA SISWA/I KELAS 4-5 MI DARUSSALAM TAHUN 2023. Diploma thesis, Poltekkes Kemenkes Tanjungkarang.

PRASETIA, MUHAMAD AGUNG (2023) ASUHAN KEPERAWATAN GANGGUAN INTEGRITAS JARINGAN PADA PASIEN ULKUSDIABETIKUM POST DEBRIDEMENTDENGAN INTERVENSIPERAWATAN LUKAMOISTWOUND HEALINGDI RUMAH SAKITMARDIWALUYOKOTA METROTAHUN 2023. Diploma thesis, Poltekkes Kemenkes Tanjungkarang.

PRASETYO T, DWI (2023) GAMBARAN KONDISI RUMAH PENDERITA ISPA PADA BALITA DI WILAYAH KERJA PUSKESMAS KOTABUMI II KABUPATEN LAMPUNG UTARA TAHUN 2023. Diploma thesis, POLTEKKES KEMENKES TANJUNGKARANG.

PRASTIWI, EKA AYU (2023) GAMBARAN TINGKAT KEPATUHAN PENERAPAN SOP PENCEGAHAN DAN PENGENDALIAN INFEKSI DI PUSKESMAS TEGINENENG TAHUN 2023. Diploma thesis, Poltekkes Kemenkes Tanjungkarang.

PRASTIWI, MUTIARA EKA (2023) UJI EFEKTIVITAS EKSTRAK ETANOL KULIT NANAS (Ananas comosus (L) merr) TERHADAP PERTUMBUHAN JAMUR Trichophyton rubrumSECARA IN-VITRO. Diploma thesis, Poltekkes Kemenkes Tanjungkarang.

PRATAMA, AFRIZAL (2023) GAMBARAN FASILITAS SANITASI SEKOLAH DASAR NEGERI UNGGULAN DENGAN TIDAK UNGGULAN DI KOTA BANDAR LAMPUNG TAHUN 2023. Diploma thesis, POLTEKKES KEMENKES TANJUNGKARANG.

PRATAMA, REGI (2023) ASUHAN KEPERAWATAN ANAK DENGAN GANGGUAN TERMOREGULASI PADA KASUS FEBRIS TERHADAP An.A DI RUANG EDELWEIS RSU HANDAYANI KOTABUMI LAMPUNG UTARA TANGGAL 22-25 Maret 2023. Diploma thesis, Poltekkes Kemenkes Tanjungkarang.

PRATAMA, REZA (2023) GAMBARAN PEMBERANTASAN SARANG NYAMUK (PSN) DEMAM BERDARAH DENGUE PADA MASYARAKAT KELURAHAN GEDONG AIR KECAMATAN TANJUNG KARANG BARAT KOTA BANDAR LAMPUNG TAHUN 2023. Diploma thesis, POLTEKKES KEMENKES TANJUNGKARANG.

PRATAMA, WAHYU AGUNG (2023) ASUHAN KEPERAWATAN GANGGUAN OKSIGENASI PADA KASUS TB PARU TERHADAP NY. H DI RUANG PARU RSD. MYJEND HM. RYACUDU KOTABUMI LAMPUNG UTARA 10 – 12 NOVEMBER 2022. Diploma thesis, Poltekkes Kemenkes Tanjungkarang.

PRATIWI, ADITYA (2023) GAMBARAN ASUPAN FE, VITAMIN C, SERAT, PENGETAHUAN GIZI DENGAN STATUS GIZI MAHASISWI DI ASRAMA RUSUNAWA UIN RADEN INTAN LAMPUNG TAHUN 2023. Diploma thesis, POLTEKKES KEMENKES TANJUNGKARANG.

PRATIWI, RATIH (2023) ASUHAN KEBIDANAN PADA BALITA Z DENGAN DETEKSI DINI PERTUMBUHAN DAN PERKEMBANGAN DI TPMB M TULANG BAWANG TENGAH, TULANG BAWANG BARAT. Diploma thesis, Poltekkes Tanjungkarang.

PRAYOGA, ILYAS INDRA (2023) PENERAPAN RELAKSASI TERHADAP PEMENUHAN KEBUTUHAN RASA NYAMAN PADA PASIEN HIPERTENSI DI RS BHAYANGKARA POLDA LAMPUNG TAHUN 2023. Diploma thesis, Poltekkes KemenkesTanjungkarang.

PRIHATINI, AYU DWI (2023) ASUHAN KEPERAWATAN GANGGUAN PEMENUHAN KEBUTUHAN OKSIGENASI PADA PASIEN PNEUMONIA DI RUANG PARU RSUD A DADI TJOKRODIPO TAHUN 2023. Diploma thesis, Poltekkes KemenkesTanjungkarang.

PRIMARAFIFA, IFTINAN (2023) PENGARUH PEMBERIAN TERAPI AKUPRESURTERHADAPPERUBAHAN NYERI IBU POST OPERASI SEKSIO SESAREA DI RSIAMUTIARAPUTRIPROVINSILAMPUNG TAHUN2023. Diploma thesis, Poltekkes Kemenkes Tanjungkarang.

PROBOWATI, ENDANG (2023) ASUHAN KEBIDANAN PADA IBU HAMIL DENGAN EMESIS GRAVIDARUM DI TEMPAT PRAKTIK MANDIRI BIDAN LINDA SEPTIANA DESA BANDAR NEGERI LABUHAN MARINGGAILAMPUNG TIMUR. Diploma thesis, Poltekkes Tanjungkarang.

PUBIAN, DILLA NOPIYANA (2023) PENGARUH KOMBINASI GREEN COLOR BREATHING THERAPY DAN SUARA ALAM TERHADAP PENURUNAN KECEMASAN PASIEN PRE OPERASI DENGAN ANESTESI SPINAL DI RSUD DR. H. ABDUL MOELOEK PROVINSI LAMPUNG TAHUN 2023. Diploma thesis, Poltekkes Kemenkes Tanjungkarang.

PUJAWATI, DIAH KUSUMANING AYU (2023) UJI KEMAMPUAN MEDIA ALTERNATIF SUKUN (Artocarpus altilis)SEBAGAI PENGGANTI MEDIA PDA (Potato Dextrose Agar)UNTUK PERTUMBUHAN JAMUR Candida albicans. Diploma thesis, Poltekkes Kemenkes Tanjungkarang.

PURI IZZATI, MAIDA (2023) GAMBARAN PENERAPAN HAZARD ANALIYSIS CRITICAL CONTROL POINT (HACCP) MENU LAUK HEWANI BAHAN BAKU TELUR DI RUMAH SAKIT ADVENT BANDAR LAMPUNG TAHUN 2023. Diploma thesis, POLTEKKES KEMENKES TANJUNGKARANG.

PURNAMA, IIN (2023) GAMBARAN KADAR BORAKS PADA KERUPUK YANG DIJUAL DI PASAR PASIR GINTUNG TANJUNG KARANG PUSAT. Diploma thesis, Poltekkes KemenkesTanjungkarang.

PURNAMA, MASTIKA PUTRI (2023) PENGELOLAAN LIMBAH MEDIS PADAT B3 DI RUMAH SAKIT UMUM DAERAH BATIN MANGUNAN KABUPATEN TANGGAMUS TAHUN 2023. Diploma thesis, Poltekkes Tanjungkarang.

PURWANINGRUM, SALSABILA INDAH (2023) PENGARUH RELAKSASI NAFAS DALAM TERHADAP PENURUNAN NYERI PADA PASIEN POST OPERASI FRAKTUR DI RSUD Dr. H. ABDUL MOELOEK PROVINSI LAMPUNG TAHUN 2023. Diploma thesis, Poltekkes Kemenkes Tanjungkarang.

PURWANINGSIH, YENI (2023) ASUHAN KEPERAWATAN GANGGUAN KEBUTUHAN NYERI DAN KENYAMANAN PADA PASIEN POST PARTUM SECTIO CAESAREA DENGAN RESIKO HIPOTENSI DI RSUD Dr. H ABDUL MOELOEK PROVINSI LAMPUNG TAHUN 2023. Diploma thesis, Poltekkes KemenkesTanjungkarang.

PUSPITA, BELLA (2023) HUBUNGAN KARAKTERISTIK TEMPAT TINGGAL DENGAN KEBERADAAN TUNGAU DEBU RUMAH ( Dermatophagoides pteronyssinus ) PADA RUMAH PENDUDUK DI JALAN KEBON JERUK KECAMATAN BUKIT KEMUNING. Diploma thesis, Poltekkes KemenkesTanjungkarang.

PUSPITA, DELLA (2023) PERBEDAAN PENGARUH AROMATERAPI LAVENDER TERHADAP PENURUNAN TINGKAT NYERI PADA PASIEN PRIA DAN WANITA POST OPERASI LAPARATOMI DI RSUD Dr. H. ABDUL MOELOEK TAHUN 2023. Diploma thesis, Poltekkes Kemenkes Tanjungkarang.

PUSPITA, ELVA (2023) GAMBARAN PENDERITA MALARIA PADA USIA PRODUKTIF. Diploma thesis, Poltekkes KemenkesTanjungkarang.

PUSPITA, TIARA (2023) ASUHAN KEPERAWATAN GANGGUAN KEBUTUHAN FISIOLOGIS: NEUROSENSORI PADA KLIEN DEMENSIA DI DUSUN SRIMULYO DESA PEMANGGILAN NATAR KABUPATEN LAMPUNG SELATAN TAHUN 2023. Diploma thesis, Poltekkes KemenkesTanjungkarang.

PUSPITA SARI, SELLY (2023) GAMBARAN KONTAMINASI MIKROBIOLOGIS PADA PERALATAN MAKAN DAN MINUM DI RUMAH MAKAN IBU SUGENG DESA ADIJAYA KABUPATEN LAMPUNG TENGAH TAHUN 2023. Diploma thesis, POLTEKKES KEMENKES TANJUNGKARANG.

PUSPITANINGRUM, AMBAR (2023) PENGARUH TEKNIK RELAKSASI NAFAS DALAM TERHADAP KEJADIAN POSTOPERATIVE NAUSEA AND VOMITING (PONV) PADA PASIEN POST OPERASI DENGAN SPINAL ANESTESI DI RSUD Dr. H. ABDUL MOELOEK PROVINSI LAMPUNG TAHUN 2023. Diploma thesis, Poltekkes KemenkesTanjungkarang.

PUSPITASARI, SHELVIA (2023) HUBUNGAN LAMANYA PENGGUNAAN WAKTU TINDAKAN KEPERAWATAN DENGAN PERSEPSI NYERI PASIEN POST OPERASI DI RSUD JEND AHMAD YANI METRO PROVINSI LAMPUNG. Diploma thesis, Poltekkes Kemenkes Tanjungkarang.

PUSPITASARI, TRIAS (2023) ASUHAN KEPERAWATAN DENGAN GANGGUAN KEBUTUHAN AKTIVITAS DAN ISTIRAHAT PADA KASUS STROKE NON HAEMORAGIC TERHADAP TN. S DI RUANG PENYAKIT DALAM RUMAH SAKIT DAERAH H.M RYACUDU KOTABUMI LAMPUNG UTARA TANGGAL 15-17 NOVEMBER TAHUN 2022. Diploma thesis, Poltekkes Kemenkes Tanjungkarang.

PUTRA, ALDO ANGGA (2023) HUBUNGAN USIA DAN INDEKS MASSA TUBUH DENGAN KEJADIAN HIPOTENSI POST ANESTESI SPINAL PADA PASIEN SECTIO CAESAREA DI RSIA ANUGERAH MEDICAL CENTER KOTA METROTAHUN 2023. Diploma thesis, Poltekkes Kemenkes Tanjungkarang.

PUTRI, ALVIRA NABILA (2023) ASUHAN KEPERAWATAN NYERI AKUT PADA PASIEN FRAKTUR POST OPERASI ORIF(OPEN REDUCTION INTERNAL FIXATION) DI RUMAH SAKIT BHAYANGKARA POLDA LAMPUNG. Diploma thesis, Poltekkes Kemenkes Tanjungkarang.

PUTRI, ALYAA RAMADHANIA (2023) KAJIAN PEMBUATAN BOLU KUKUS DENGAN SUBSTITUSI TEPUNG KACANG MERAH DAN TEPUNG BIT SEBAGAI MAKANAN SELINGAN TINGGI ZAT BESI TAHUN 2023. Diploma thesis, POLTEKKES KEMENKES TANJUNGKARANG.

PUTRI, AMAILIA NURFAIDA (2023) GAMBARAN PENYEDIAAN AIR BERSIH DAN JAMBAN PADA PENDERITA DIARE DI WILAYAH KERJA PUSKESMAS PUGUNG RAHARJO KECAMATAN SEKAMPUNG UDIK KABUPATEN LAMPUNG TIMUR TAHUN 2023. Diploma thesis, POLTEKKES KEMENKES TANJUNGKARANG.

PUTRI, ANGGI APRILIA (2023) ASUHAN IBU HAMIL DENGAN HIPERTENSI DI TPMB TRIANA ANJARINI WAY JEPARA LAMPUNG TIMUR. Diploma thesis, Poltekkes Tanjungkarang.

PUTRI, ANISA DWI (2023) ASUHAN KEPERAWATAN DENGAN GANGGUAN KEBUTUHAN OKSIGENASI PADA KASUS CEDERA KEPALA BERAT TERHADAP TN. H DI RUANG IGD RSUD JENDRAL AHMAD YANI METRO TANGGAL 05 NOVEMBER 2022. Diploma thesis, Poltekkes Kemenkes Tanjungkarang.

PUTRI, ANNISA (2023) ASUHAN KEBIDANAN KETERLAMBATAN BICARA DAN BAHASA DENGAN METODE ORAL MOTOR EXERCISE PADA BALITA DITPMB KISWARI HADIMULYO TIMUR KOTA METRO. Diploma thesis, Poltekkes Tanjungkarang.

PUTRI, ANNISA NABILA (2023) ASUHAN KEPERAWATAN GANGGUAN KEBUTUHAN OKSIGENASI PADA PASIEN CONGESTIVE HEART FAILURE (CHF) DIRUANG TULIP RSUD Dr. H. ABDUL MOELOEK PROVINSI LAMPUNG TAHUN 2023. Diploma thesis, Poltekkes KemenkesTanjungkarang.

PUTRI, ANNISA YULISTIANI (2023) FAKTOR PENYEBAB RENDAHNYAKUNJUNGAN PELAYANAN KESEHATAN GIGI DAN MULUT DI PUSKESMAS BUKIT KEMUNING KABUPATEN LAMPUNG UTARA TAHUN 2023. Diploma thesis, Poltekkes Kemenkes Tanjungkarang.

PUTRI, ARINDA AULIA (2023) PERSEPSI MASYARAKAT MENGENAI PENGGUNAAN OBAT TRADISIONAL SEBAGAI PENGOBATAN ALTERNATIF DI KELURAHAN KURIPAN KECAMATAN KOTAAGUNG KABUPATEN TANGGAMUS. Diploma thesis, Poltekkes KemenkesTanjungkarang.

PUTRI, ARRAHMA SALSABILA (2023) MANAJEMEN RISIKO PADA PENGELOLAAN LIMBAH MEDIS PADAT BAHAN BERBAHAYA BERACUN (B3) DI RUMAH SAKIT UMUM DAERAH JEND. A. YANI METRO TAHUN 2023. Diploma thesis, Poltekkes Tanjungkarang.

PUTRI, ARTA PRATAMA (2023) PENATALAKSANAAN ASUHAN GIZI TERSTANDAR PADA PASIEN DIABETES MELLITUS TIPE II DENGAN HIPERTENSI DI RUANG RAWAT INAP KELAS III RSUD MENGGALA TAHUN 2023. Diploma thesis, POLTEKKES KEMENKES TANJUNGKARANG.

PUTRI, AS SYIFA’ AMANDA (2023) GAMBARAN FAKTOR-FAKTOR YANG BERHUBUNGAN DENGAN STATUS GIZI ANAK USIA SEKOLAH DI MADRASAH IBTIDAIYAH DARUSSALAM KECAMATAN BANDAR SURABAYA KABUPATEN LAMPUNG TENGAH TAHUN 2023. Diploma thesis, POLTEKKES KEMENKES TANJUNGKARANG.

PUTRI, DELLA SHINDYA (2023) ASUHAN KEBIDANAN KEHAMILAN DENGAN EMESIS GRAVIDARUM DI TEMPAT PRAKTIK MANDIRI BIDAN SRI UTAMI BANGUN REJO. Diploma thesis, Poltekkes Tanjungkarang.

PUTRI, DINA AMELIA (2023) ASUHAN KEBIDANAN PADA IBU NIFAS DENGAN BENDUNGAN ASI DI TEMPAT PRAKTIK MANDIRI BIDAN MARWANI LAMPUNG TENGAH. Diploma thesis, Poltekkes Tanjungkarang.

PUTRI, ENJLLE NADA (2023) GAMBARAN PERILAKU MAKAN, ASUPAN ZAT GIZI DAN STATUS GIZI PADALANSIA DI DESA WAYTAWAR KABUPATEN WAYKANAN TAHUN 2023. Diploma thesis, Poltekkes KemenkesTanjungkarang.

PUTRI, ERIKA MULIA PANCA (2023) GAMBARAN SANITASI DASAR DI SEKOLAH DASAR NEGERI KEC. PESISIR SELATAN KAB.PESISIR BARAT TAHUN 2023. Diploma thesis, POLTEKKES KEMENKES TANJUNGKARANG.

PUTRI, ERLYN ARLES TIA NANDA (2023) UJI DAYA HAMBAT EKSTRAK ETANOL DAUN JAMBU BIJI (Syzygium guajava L.) TERHADAP PERTUMBUHAN BAKTERI Shigella dysenteriae. Diploma thesis, Poltekkes KemenkesTanjungkarang.

PUTRI, FADHILAH AZZAH (2023) PENATALAKSANAAN ASUHAN GIZI TERSTANDAR PADA PASIEN PENDERITA GAGAL GINJAL KRONIK DENGAN ANEMIA DI RSUD JENDERAL AHMAD YANI METRO 2023. Diploma thesis, Poltekkes Kemenkes Tanjungkarang.

PUTRI, GRACIA ERNI (2023) PREVALENSI PENDERITA MALARIA DI UPT PUSKESMAS RAWAT INAP PADANG CERMIN KABUPATEN PESAWARAN TAHUN 2020-2022. Diploma thesis, Poltekkes KemenkesTanjungkarang.

PUTRI, GUSHERWANTI PANCA (2023) GAMBARAN DAGUSIBU OBAT KORTIKOSTEROID DI KELURAHAN KETEGUHAN KECAMATAN TELUK BETUNG TIMUR KOTA BANDAR LAMPUNG. Diploma thesis, Poltekkes KemenkesTanjungkarang.

PUTRI, HANA ELSI (2023) ASUHAN KEPERAWATAN GAWAT DARURAT DENGAN GANGGUAN OKSIGENASI PADA KASUS POST OP KRANIOTOMI e.c INTRACEREBRAL HEMORRHAGE TERHADAP Ny. S DI RUANGAN ICU RSUD JENDRAL AHMAD YANI KOTA METRO TANGGAL 08 – 09 NOVEMER 2022. Diploma thesis, Poltekkes Kemenkes Tanjungkarang.

PUTRI, IIS ELINDA (2023) ASUHAN KEPERAWATAN GANGGUAN OKSIGENASI PADA PENYAKIT PARU OBSTRUKTIF KRONIK (PPOK) TERHADAP NY. J DI INSTALASI GAWAT DAURAT RSU HANDAYANI KOTABUMI LAMPUNG UTARA TANGGAL 24 NOVEMBER 2022. Diploma thesis, Poltekkes Kemenkes Tanjungkarang.

PUTRI, JELITA (2023) GAMBARANTINGKATKECEMASANANAKUSIA5-12 TAHUNTERHADAPPERAWATANGIGIDIPOLIGIGI PUSKESMASBRANTIRAYATAHUN2023. Diploma thesis, Poltekkes Kemenkes Tanjungkarang.

PUTRI, MUFLICHAH FEBRIANI EKA (2023) DETERMINAN KEJADIAN DEMAM TYPHOID DI WILAYAH KERJA PUSKESMAS RAWAT INAP KEMILING KOTA BANDAR LAMPUNG TAHUN 2023. Diploma thesis, Poltekkes Kemenkes Tanjung Karang.

PUTRI, NABILA AMANDA (2023) PENGARUH EDUKASI MENGGUNAKAN MEDIA BOOKLET DAN AUDIO VISUAL TERHADAP KEMAMPUAN MOBILISASI DINI PASIEN POST OPERASI LAPARATOMI DI RSUD Dr. H. ABDUL MOELOEK PROVINSI LAMPUNG TAHUN 2023. Diploma thesis, Poltekkes Kemenkes Tanjungkarang.

PUTRI, NABILLAH AISYAH (2023) ASUHAN KEBIDANAN PERSALINAN DALAM MENGURANGI NYERI PADA KALA 1 DENGAN KOMPRES HANGAT DI TEMPAT PRAKTIK MANDIRI BIDAN OKTARIA ANDRIANI, PENUMANGAN BARU TULANG BAWANG BARAT. Diploma thesis, Poltekkes Tanjungkarang.

PUTRI, NELYANA (2023) GAMBARAN PENGELOLAAN MAKANAN DI TEMPAT MAKAN JL. IR. SUTAMI DESA LEMATANG TAHUN 2023. Diploma thesis, POLTEKKES KEMENKES TANJUNGKARANG.

PUTRI, NI KADEK CHANDRIKA (2023) GAMBARAN ANGKA BEBAS JENTIK (ABJ) DIKELURAHAN PERUMNAS WAY KANDIS WILAYAH KERJA PUSKESMAS WAY KANDIS TAHUN 2023. Diploma thesis, POLTEKKES KEMENKES TANJUNGKARANG.

PUTRI, OKTAVIA NURSYIFA (2023) GAMBARAN PENGETAHUAN PELIHARA DIRI TENTANGKESEHATAN GIGI DAN MULUT ANAK USIA 8-9 TAHUNSDN1KAMPUNGKOTAAGUNGTANGGAMUSTAHUN2023. Diploma thesis, Poltekkes Kemenkes Tanjungkarang.

PUTRI, RIKA AMANDA (2023) GAMBARAN JENIS DAN DERAJAT ANEMIA PADA PENDERITA DEMAM BERDARAH DENGUE (DBD) DI UPT PUSKESMAS KAMPUNG SAWAH KOTA BANDAR LAMPUNG TAHUN 2022. Diploma thesis, Poltekkes KemenkesTanjungkarang.

PUTRI, ROLA SINTIA (2023) ASUHAN KEPERAWATAN KETIDAKSTABILAN KADAR GLUKOSA DARAH PADA PASIEN DIABETES MELITUS DI RUMAH SAKIT BHAYANGKARA POLDA LAMPUNG TAHUN 2023. Diploma thesis, Poltekkes KemenkesTanjungkarang.

PUTRI, SALSABILA (2023) PERBEDAAN SATURASI OKSIGEN PADA PETUGAS PARKIR ANTARA BASEMENT DAN UPPER GROUND DI MALL BOEMI KEDATON TAHUN 2023. Diploma thesis, Poltekkes Kemenkes Tanjung Karang.

PUTRI, SANIDA APRILIANA (2023) ASUHAN KEPERAWATAN PASIEN DENGAN GANGGUAN OKSIGENASI PADA KASUS PNEUMONIA TERHADAP TN. F DI RUANG VIP C RUMAH SAKIT UMUM DAERAH MAYJEND HM RYACUDU KOTABUMI LAMPUNG UTARA TANGGAL 7-9 NOVEMBER 2022. Diploma thesis, Poltekkes Kemenkes Tanjungkarang.

PUTRI, SISILIA ALDA (2023) ASUHAN KEPERAWATAN DENGAN GANGGUAN TERMOGULASI PADA KASUS KEJANG DEMAM TERHADAP AN. H DI RUANG EDELWEIS RSU HANDAYANI KOTABUMI LAMPUNG UTARA TANGGAL 05-07 APRIL 2023. Diploma thesis, Poltekkes Kemenkes Tanjungkarang.

PUTRI, TIARA (2023) GAMBARAN KADAR KOLESTEROL TOTAL PADA PENDERITA HIPERTENSI DI PUSKESMAS SATELIT KOTA BANDAR LAMPUNG TAHUN 2021-2022. Diploma thesis, Poltekkes KemenkesTanjungkarang.

PUTRI, WAYAN PANCA (2023) GAMBARAN INDEKS JENTIK NYAMUK AEDES AEGYPTI DI WILAYAH KERJA PUSKESMAS BANJIT KECAMATAN BANJIT KABUPATEN WAY KANAN TAHUN 2023. Diploma thesis, POLTEKKES KEMENKES TANJUNGKARANG.

PUTRI, WILDA NINDIA (2023) KEMAMPUAN ECENG GONDOK (Eichhornia Crassipes) SEBAGAI FITOREMEDIASI DALAM PENGOLAHAN LIMBAH CAIR INDUSTRI TEMPE. Diploma thesis, Poltekkes Kemenkes Tanjung Karang.

PUTRI, YODIAS YAKHINTA (2023) EVALUASI TEKNIS IPAL KOMUNAL DI KAMPUNG RAMA GUNAWAN KECAMATAN SEPUTIH RAMAN TAHUN 2023. Diploma thesis, Poltekkes Tanjungkarang.

PUTRI, YOSI NABILA (2023) ASUHAN KEPERAWATAN ANAK DENGAN GANGGUAN OKSIGENASI PADA KASUS ASMA BRONKIAL TERHADAP AN. R DI RUANG EDELWEIS RSU HANDAYANI KOTABUMI LAMPUNG UTARA TANGGAL 20-25 MARET 2023. Diploma thesis, Poltekkes Kemenkes Tanjungkarang.

PUTRI RAHMAN, SALSABILA (2023) PERENCANAAN SISTEM PENGELOLAAN SAMPAH DI PASAR GADING REJO KABUPATEN PRINGSEWU TAHUN 2023. Diploma thesis, POLTEKKES KEMENKES TANJUNGKARANG.

PUTRI WINANDI, RIZKA (2023) ASUHAN KEBIDANAN PADA IBU NIFAS DENGAN BENDUNGAN ASI DI KLINIK AN-NUR HUSADA DAYA MURNI TULANG BAWANG BARAT. Diploma thesis, Poltekkes Tanjungkarang.

PUTRIANI, EKA (2023) GAMBARAN FAKTOR-FAKTOR YANG MEMPENGARUHI SISA MAKANAN LUNAK PADA PASIEN RAWAT INAP KELAS III RSUD BATIN MANGUNANG TANGGAMUS TAHUN 2023. Diploma thesis, Poltekkes KemenkesTanjungkarang.

Pratiwi, Nadia Eka (2023) ASUHAN KEPERAWATAN KELUARGA DENGAN GANGUAN RASA AMAN DAN NYAMAN PADA KASUS HIPERTENSI TERHADAP TN. C DI DESA ALAM JAYA KABUPATEN LAMPUNG UTARA TANGGAL 11-15 OKTOBER 2022. Diploma thesis, Poltekkes Kemenkes Tanjungkarang.

Purbaya, Bayu Firmansyah (2023) PERANAN ARTIKULATOR DALAM PEMBUATAN GIGI TIRUAN DI LABORATORIUM TEKNIK GIGI POLITEKNIK KESEHATAN TANJUNG KARANG. Diploma thesis, Poltekkes KemenkesTanjungkarang.

Purbaya, Bayu Firmansyah (2023) PERANAN ARTIKULATOR DALAM PEMBUATAN GIGI TIRUAN DI LABORATORIUM TEKNIK GIGI POLITEKNIK KESEHATAN TANJUNG KARANG. Diploma thesis, Poltekkes KemenkesTanjungkarang.

Putra, Deni (2023) ASUHAN KEPERAWATAN GANGGUAN KEBUTUHAN RASA NYAMAN PADA KLIEN HIPERKOLESTEROLEMIA DALAM KELUARGA DI DUSUN SRIMULYO I DESA PEMANGGILAN KECAMATAN NATAR KABUPATEN LAMPUNG SELATAN TAHUN 2023. Diploma thesis, Poltekkes KemenkesTanjungkarang.

Putri, Christella Andika Permana (2023) GAMBARAN PERSENTASE KEBERHASILAN DAN KEGAGALAN DALAM PEMBUATAN GIGI TIRUAN SEBAGIAN LEPASAN FLEXY DI LABORATORIUM JURUSAN TEKNIK GIGI POLITEKNIK KESEHATAN TANJUNGKARANG TAHUN 2023. Diploma thesis, Poltekkes KemenkesTanjungkarang.

Putri, Nabila Stepani (2023) PEMBUATAN GIGI TIRUAN SEBAGIAN LEPASAN AKRILIK RAHANG ATAS DAN RAHANG BAWAH FREE END DENGAN KASUS RESORBSI TULANG ALVEOLAR. Diploma thesis, Poltekkes KemenkesTanjungkarang.

Putri, Sekar Ayu Arind (2023) GAMBARAN STATUS ANEMIA PADA REMAJA PUTRI KELAS XI DI SMA SWADHIPA NATAR KECAMATAN NATAR KABUPATEN LAMPUNG SELATAN TAHUN 2023. Diploma thesis, POLTEKKES KEMENKES TANJUNGKARANG.

R

RAAFIK AKMAL, ICHAN (2023) GAMBARAN PERILAKU HIDUP BERSIH DAN SEHAT (PHBS)PADA SISWA SEKOLAH DASAR DI KECAMATAN BATU BRAK KABUPATEN LAMPUNG BARAT TAHUN 2023. Diploma thesis, POLTEKKES KEMENKES TANJUNGKARANG.

RACHMAWATI, DEWI APRILIA RACHMAWATI (2023) EVALUASI PROGRAM STOP BUANG AIR BESAR SEMBARANGAN DI WILAYAH KERJA PUSKESMAS RAWAT INAP KOTA KARANG KECAMATAN TELUK BETUNG TIMUR KOTA BANDAR LAMPUNG TAHUN 2023. Diploma thesis, Poltekkes Kemenkes Tanjung Karang.

RAHAYU, PUTRI (2023) ASUHAN KEPERAWATAN GANGGUAN KEBUTUHAN CAIRAN PADA PASIEN PENDARAHAN POSTPARTUM PERVAGINA DI RUANG DELIMA SRUD Dr. H ABDUL MOELOEK PROVINSI LAMPUNG TAHUN 2023. Diploma thesis, Poltekkes KemenkesTanjungkarang.

RAHAYU, PUTRI (2023) GAMBARAN PENGELOLAAN LIMBAH MEDIS PADAT DI RUMAH SAKIT UMUM DAERAH MAYJEND HM RYACUDU KOTABUMI TAHUN 2023. Diploma thesis, POLTEKKES KEMENKES TANJUNGKARANG.

RAHMA, AULIA (2023) GAMBARAN PENGETAHUAN DAN PERILAKU TENTANG HYGIENE SANITASI MAKANAN PADA PEDAGANG KAKI LIMA DI LAPANGAN SAMBER KOTA METRO TAHUN 2023. Diploma thesis, POLTEKKES KEMENKES TANJUNGKARANG.

RAHMA, DWI PUTRI JULIA (2023) ASUHAN KEBIDANAN PADA IBU BERSALIN UNTUK PENGURANGAN NYERI KALA 1 FASE AKTIF DI TPMB WINDRA SANDRA LAMPUNG TENGAH. Diploma thesis, Poltekkes Tanjungkarang.

RAHMA, FARA AULIA (2023) GAMBARAN POLA KONSUMSI SAYUR DAN BUAH PADA SISWA KELAS 9 DI SMPN 1 KOTAAGUNG TAHUN 2023. Diploma thesis, POLTEKKES KEMENKES TANJUNGKARANG.

RAHMADANI, DESY (2023) ASUHAN KEPERAWATAN POST OPERASI DIABETES MELLITUS DENGAN TINDAKANDEBRIDEMENTDENGAN MASALAH KEPERAWATAN GANGGUAN INTEGRITAS KULIT DI RUMAH SAKIT MARDI WALUYO METRO. Diploma thesis, Poltekkes Kemenkes Tanjungkarang.

RAHMADANI, MAYA FITRIA (2023) ASUHAN KEBIDANAN KEHAMILAN TM III UNTUK MENGURANGI NYERI PUNGGUNG DENGAN SENAM PILATES DI MONICA DIAN TULANG BAWANG BARAT. Diploma thesis, Poltekkes Tanjungkarang.

RAHMADHANI, ALYZEA PUTRI (2023) GAMBARAN PENGETAHUAN GIZI, ASUPAN GIZI DAN STATUS GIZI ATLET RENANG CLUB FLIPPER KOTA METRO TAHUN 2023. Diploma thesis, POLTEKKES KEMENKES TANJUNGKARANG.

RAHMADHANI, TRI PANGESTU (2023) EFEKTIVITAS PEMBERIAN TEKNIK RELAKSASI NAFAS DALAM TERHADAP RESPON FISIOLOGIS PADA PASIEN PRE OPERASIDI RS BHAYANGKARA PROVINSI LAMPUNG TAHUN 2022. Diploma thesis, Poltekkes Kemenkes Tanjungkarang.

RAHMADHANI, TRI PANGESTU (2023) PENERAPAN AROMATERAPI LEMON PADA PASIEN POST LAPARATOMIDENGAN MASALAH NYERI AKUT DIRSUDDR.H ABDUL MOELOEK PROVINSILAMPUNG TAHUN2023. Diploma thesis, Poltekkes Kemenkes Tanjungkarang.

RAHMADHANY, AJENG (2023) GAMBARAN PROSES PENDISTRIBUSIAN MAKANAN DI INSTALASI GIZI RSUD MAYJEN HM RYACUDU KOTABUMI PROVINSI LAMPUNG TAHUN 2023. Diploma thesis, POLTEKKES KEMENKES TANJUNGKARANG.

RAHMAH, ZAKIA NUR (2023) ASUHAN KEPERAWATAN PASIEN DENGAN GANGGUAN RASA AMAN NYAMAN PADA KASUS POST APENDIKTOMI TERHADAP Ny. L DI RUANG FREESIA LANTAI 4 RUMAH SAKIT UMUM HANDAYANI KOTABUMI LAMPUNG UTARA TANGGAL 7-9 NOVEMBER 2022. Diploma thesis, Poltekkes Kemenkes Tanjungkarang.

RAHMAINI, DITA (2023) UJI DAYA HAMBAT EKSTRAK DAUN KATUK (SauropusandrogynusL. Merr) TERHADAP PERTUMBUHAN JAMUR Aspergillus flavus. Diploma thesis, Poltekkes Kemenkes Tanjungkarang.

RAHMALIA, ANNISA (2023) PENGARUH TEKNIK RELAKSASI DAN TERAPI PIJAT TERHADAP PENURUNAN INTENSITAS NYERI POST SC DI RUMAH SAKIT ANUGERAH MEDICAL CENTER KOTA METRO PROVINSI LAMPUNG TAHUN 2023. Diploma thesis, Poltekkes Kemenkes Tanjungkarang.

RAHMAN, AMRI WIJAYA (2023) PENGARUH TEKNIK RELAKSASI GUIDED IMAGERY TERHADAP KECEMASAN PASIEN PRE OPERASI LAPAROTOMY DI RSUD JENDERAL AHMAD YANI KOTA METRO LAMPUNG TAHUN 2023. Diploma thesis, Poltekkes KemenkesTanjungkarang.

RAHMASARI, RINDIANA (2023) GAMBARAN KEJADIAN SCABIES DI WILAYAH KERJA PUSKESMAS RAJABASA INDAH BANDAR LAMPUNG TAHUN 2022. Diploma thesis, Poltekkes Tanjungkarang.

RAHMATICA, FARAH DESYA (2023) ASUHAN KEPERAWATAN DENGAN GANGGUAN KEBUTUHAN RASA NYERI DAN KENYAMANAN PADA PASIEN ASAM URAT DI DESA PEMANGGILAN NATAR LAMPUNG SELATAN TAHUN 2023. Diploma thesis, Poltekkes KemenkesTanjungkarang.

RAHMATUZZAHRA, RAHMATUZZAHRA (2023) PERBANDINGAN METODE EKSTRAKSI SOXHLETASI DAN MASERASI TERHADAP AKTIVITAS ANTIOKSIDAN EKSTRAK BUAH CABAI JAWA (Piper retrofractum Vahl) DENGAN METODE DPPH. Diploma thesis, Poltekkes Tanjungkarang.

RAHMAWATI, ANNISA INDAH (2023) MANAJEMEN RISIKO KESELAMATAN DAN KESEHATAN KERJA (K3) DI WILAYAH KERJA PEMBANGKIT LISTRIK TENAGA UAP UPK SEBALANG TARAHAN LAMPUNG SELATAN. Diploma thesis, Poltekkes Tanjungkarang.

RAHMAWATI, DINA (2023) ASUHAN KEPERAWATAN GANGGUAN KEBUTUHAN AKTIVITAS DAN ISTIRAHAT PADA PASIEN CONGESTIVE HEART FAILURE DI RUANG JANTUNG RSUD Dr. H. ABDUL MOELOEK PROVINSI LAMPUNG TAHUN 2023. Diploma thesis, Poltekkes KemenkesTanjungkarang.

RAHMAWATI, LILIS (2023) GAMBARANKEPEMILIKAN JAMBAN DI DAERAH PASANG SURUT DESA SIDODADI KABUPATEN PESAWARAN TAHUN 2023. Diploma thesis, POLTEKKES KEMENKES TANJUNGKARANG.

RAHMAWATI, NEVY (2023) GAMBARAN SANITASI LINGKUNGAN RUMAH PENDERITA STUNTING DI PUSKESMAS RAWAT INAP PENENGAHAN KABUPATEN LAMPUNG SELATAN TAHUN 2023. Diploma thesis, POLTEKKES KEMENKES TANJUNGKARANG.

RAHMAWATI, SETIA (2023) PENERAPAN AROMATERAPI LAVENDER PADA PASIEN POST DEBRIDEMENT ULKUS DIABETIKUM DENGAN MASALAH KEPERAWATAN NYERI DI RSUD JENDERAL AHMAD YANI KOTA METRO TAHUN 2023. Diploma thesis, Poltekkes Kemenkes Tanjungkarang.

RAMADANI, PUTRI (2023) FORMULASI SEDIAAN LIP BALM EKSTRAK BUAH SENGGANI (Melastoma malabathricum L.). Diploma thesis, Poltekkes KemenkesTanjungkarang.

RAMADHAN, ANISA DWI (2023) ASUHAN KEPERAWATAN PASIEN DENGAN HARGA DIRI RENDAH KRONIS PADA KASUS SKIZOFRENIA TERHADAP Tn. S DI RUANG KUTILANG RUMAH SAKIT JIWA DAERAH PROVINSI LAMPUNG TANGGAL 1-3 MARET 2022. Diploma thesis, Poltekkes Kemenkes Tanjungkarang.

RAMADHAN, ANISA DWI (2023) ASUHAN KEPERAWATAN PASIEN DENGAN HARGA DIRI RENDAH KRONIS PADA KASUS SKIZOFRENIA TERHADAP Tn. S DI RUANG KUTILANG RUMAH SAKIT JIWA DAERAH PROVINSI LAMPUNG TANGGAL 1-3 MARET 2022. Diploma thesis, Poltekkes Kemenkes Tanjungkarang.

RAMADHAN, ANISA DWI (2023) ASUHAN KEPERAWATAN PASIEN DENGAN HARGA DIRI RENDAHKRONIS PADA KASUS SKIZOFRENIA TERHADAP TN.S DI RUANG KUTILANG RUMAH SAKIT JIWA DAERAH PROVINSI LAMPUNG. TANGGAL 1-3 MARET 2022. Diploma thesis, Poltekkes Kemenkes Tanjungkarang.

RAMADHAN, ANUGERAH BINTANG (2023) GAMBARAN PENGETAHUAN DAN SIKAP PETANI PENGGUNA PESTISIDA DALAM PEMAKAIAN ALAT PELINDUNG DIRI (APD) DI KELURAHAN SUMBERSARI KECAMATAN METRO SELATAN KOTA METRO TAHUN 2023. Diploma thesis, POLTEKKES KEMENKES TANJUNGKARANG.

RAMADHAN, CHRISNA WAHYU (2023) ASUHAN KEPERAWATAN GANGGUAN INTEGRITASJARINGAN PADA PASIEN ULKUS DIABETIKUMPOSTDEBRIDEMENT DI RSUD JENDRAL AHMADYANIMETRO TAHUN 2023. Diploma thesis, Poltekkes Kemenkes Tanjungkarang.

RAMADHAN, GALUH (2023) ASUHAN KEPERAWATAN PASIEN DENGAN GANGGUAN RASA NYAMAN PADA KASUS POST SECTIO CAESAREA TERHADAP NY. A DI RUANG KEBIDANAN RSU HANDAYANI KOTABUMI LAMPUNG UTARA TANGGAL 27-29 MARET 2023. Diploma thesis, Poltekkes Kemenkes Tanjungkarang.

RAMADHANI, KATRINA CHIKA (2023) FAKTOR-FAKTOR YANG BERHUBUNGAN DENGAN KEJADIANTUBERCULOSIS MULTIDRUG RESISTANT (TB MDR) DI RSUD Dr.H.ABDUL MOELOEK KOTA BANDAR LAMPUNG TAHUN 2023. Diploma thesis, Poltekkes Kemenkes Tanjungkarang.

RAMADHANTY, DHITA (2023) HUBUNGAN ANTARA KELEMBABAN RUANGAN TEMPAT TINGGAL DAN PERSONAL HYGIENE DENGAN KEJADIAN PANU (Pityriasis versicolor) PADA PENGHUNI BEDENG DIVISI 1 PT. SWEET INDOLAMPUNG SUGAR GROUP KABUPATEN TULANG BAWANG. Diploma thesis, Poltekkes KemenkesTanjungkarang.

RAMADHON, RACHMAD (2023) ASUHAN KEPERAWATAN GERONTIK DENGAN GANGGUAN AKTIVITAS DAN ISTIRAHAT PADA KASUS STROKE NON HEMORAGIK TERHADAP TN. M DI DESA TANJUNG HARAPAN WILAYAH KERJA PUSKESMAS KOTABUMI II KABUPATEN LAMPUNG UTARA TANGGAL 18-20 MARET 2023. Diploma thesis, Poltekkes Kemenkes Tanjungkarang.

RAMADHONI, M. ISMAIL (2023) HUBUNGAN AKTIVITAS KOLINESTERASE DENGANAKTIVITASSGPT DAN SGOT AKIBAT PAJANANPESTISIDA PADA PETANI DIKECAMATANNATAR. Diploma thesis, Poltekkes Kemenkes Tanjungkarang.

RAMANANDITA, KANIA FHARA (2023) PERBEDAAN HASIL PEMERIKSAAN REDUKSI URINE METODE BENEDICT SEBELUM DAN SESUDAH KONSUMSI VITAMIN C DOSIS 1000 mg. Diploma thesis, Poltekkes Kemenkes Tanjungkarang.

RANTI FITRIANI, HANIFAH (2023) GAMBARAN LINGKUNGAN FISIK, KARAKTERISTIK DAN PERILAKU PENDERITA TUBERCULOSIS PARU DI WILAYAH KERJA PUSKESMAS LABUHAN RATU KOTA BANDAR LAMPUNG TAHUN 2023. Diploma thesis, POLTEKKES KEMENKES TANJUNGKARANG.

RAPIH FELISA NANDA, ADITIAS (2023) GAMBARAN PEMANFAATAN TANAMAN OBAT TRADISIONAL UNTUK MENINGKATKAN PRODUKSI AIR SUSU IBU (ASI) DI DESA SRIDADI KECAMATAN WONOSOBO KABUPATEN TANGGAMUS. Diploma thesis, Poltekkes KemenkesTanjungkarang.

RAPLY, MAULANA YUSUF (2023) HUBUNGAN TINGKAT PENDIDIKAN, PENGETAHUAN IBU DALAM MENYIKAT GIGI TERHADAP OHIS ANAK SD KELAS V-VI DI SD NEGERI 2 SUKADANA. Diploma thesis, Poltekkes Kemenkes Tanjungkarang.

REFIKA, LINDA (2023) FORMULASI LIPGLOSS EKSTRAK KULIT BUAH MELINJO MERAH (Gnetum gnemon L.) DENGAN PELARUT VIRGIN COCONUT OIL (VCO). Diploma thesis, Poltekkes KemenkesTanjungkarang.

REFKIAWAN, M. EGI (2023) ASUHAN KEPERAWATAN GANGGUAN KEBUTUHAN KEAMANAN DAN PROTEKSI THERMOGULASI PADA PASIEN DENGUE HEMORAGIC FEVER (DHF) DI RUANG ALAMANDA RSUD Dr. H ABDUL MOELOEK PROVINSI LAMPUNG TAHUN 2023. Diploma thesis, Poltekkes KemenkesTanjungkarang.

REIUS, AZZAHRA ARBELIA (2023) UJI EFEKTIVITAS EKSTRAK DAUN PEPAYA (Carica papaya L.) DALAM MENGHAMBAT PERTUMBUHAN JAMUR Candida albicans SEBAGAI SALAH SATU JAMUR PENYEBAB KETOMBE UJI EFEKTIVITAS EKSTRAK DAUN PEPAYA (Carica papaya L.) DALAM MENGHAMBAT PERTUMBUHAN JAMUR Candida albicans SEBAGAI SALAH SATU JAMUR PENYEBAB KETOMBE. Diploma thesis, Poltekkes KemenkesTanjungkarang.

REJEKI, SRI (2023) APLIKASI PENATALAKSANAAN HIPOTERMI POST OPERATIF MENGGUNAKAN ALUMINIUM BLANKET DI RUMAH SAKIT UMUM DAERAH ALIMUDDIN UMAR LAMPUNG BARAT TAHUN 2023. Diploma thesis, Poltekkes Kemenkes Tanjungkarang.

RENALDI, RENALDI (2023) ASUHAN KEPERAWATAN KELUARGA DENGAN GANGGUAN AMAN DAN NYAMAN PADA KASUS HIPERTENSI TERHADAP Ny.K DI WILAYAH KERJA PUSKESMAS KOTABUMI II KAB. LAMPUNG UTARA TANGGAL 28-30 MARET 2023. Diploma thesis, Poltekkes Kemenkes Tanjungkarang.

RENI, NOVITA (2023) ASUHAN KEBIDANAN BAYI BARU LAHIR DENGAN BBLR DI TEMPAT PRAKTIK MANDIRI BIDAN M TULANG BAWANG BARAT. Diploma thesis, Poltekkes Tanjungkarang.

RESTU AMANDA, CHIKITA (2023) Formulasi Gel Kombinasi Ekstrak Herba Pegagan (Centella asiatica (L.) Urb.) dan Ekstrak Kulit Jeruk Lemon (Citrus Limon (L.) Burm.Fil.) sebagai Anti Jerawat. Diploma thesis, Poltekkes Tanjungkarang.

REVIANI, REZY (2023) PENERAPAN PIJAT OKSITOSIN TERHADAP PRODUKSI ASI PADA IBU NIFAS TERHADAP Ny.W DI PMB TRINI,STr.Keb.SKM LAMPUNG SELATAN. Diploma thesis, Poltekkes Kemenkes Tanjungkarang.

RHAMANTIKA, RIZKY (2023) GAMBARAN FAKTOR RESIKO ANEMIA PADA REMAJA PUTRI KELAS X DI SMA GAJAH MADA BANDAR LAMPUNG TAHUN 2023. Diploma thesis, POLTEKKES KEMENKES TANJUNGKARANG.

RHEINABILA, RHEINABILA (2023) HUBUNGAN PENGETAHUAN DENGAN MOBILISASI DINI PADA PASIEN POST SECTIO CAESAREA DI RSIA ANUGERAH MEDICAL CENTER KOTA METRO PROVINSI LAMPUNG TAHUN 2023. Diploma thesis, Poltekkes KemenkesTanjungkarang.

RIA, SILA RESTU (2023) HUBUNGAN PENGETAHUAN DAN SIKAP DENGAN PERILAKU DALAM PELAKSANAAN MOBILISASI DINI PADA PASIEN POST OPERASI DI RSUD Dr.H. ABDUL MOELOEK PROVINSI LAMPUNG TAHUN 2023. Diploma thesis, Poltekkes KemenkesTanjungkarang.

RIAMADANI, ENGGAR (2023) GAMBARAN SANITASI REST AREA TOL TRANS SUMATRA RUAS BAKAUHENI - TERBANGGI BESAR TAHUN 2023. Diploma thesis, POLTEKKES KEMENKES TANJUNGKARANG.

RINDIYANTI, NOVITA (2023) PENGARUH TERAPI SENI TERHADAP PENURUNAN TINGKAT KECEMASAN PADA PASIEN PRE OPERASI DI RSUD JENDRAL AHMAD YANI METRO PROVINSI LAMPUNG TAHUN 2023. Diploma thesis, Poltekkes KemenkesTanjungkarang.

RISKIYANTI, MARISKA (2023) GAMBARAN FAKTOR INTERNAL DAN EKSTERNAL SISA MAKANAN BIASA PASIEN RAWAT INAP KELAS II DAN KELAS III DI RUMAH SAKIT BHAYANGKARA BANDAR LAMPUNG TAHUN 2023. Diploma thesis, POLTEKKES KEMENKES TANJUNGKARANG.

RISTA, RINDU DEA LUTHFIATUL (2023) GAMBARAN INDEKS MASSA TUBUH, LINGKARPINGGANG, DAN POLA MAKAN PADA LANSIAPENDERITA ASAM URAT DI RT 05 KETEGUHANKECAMATAN TELUK BETUNG TIMURBANDAR LAMPUNGTAHUN 2023. Diploma thesis, POLTEKKES KEMENKES TANJUNGKARANG.

RISTANTIWI, ARETH (2023) GAMBARAN PROFIL ERITROSIT PADA WANITA LANJUT USIA DI UPTD PELAYANAN SOSIAL LANJUT USIA TRESNA WERDHA KECAMATAN NATAR KABUPATEN LAMPUNG SELATAN TAHUN 2023. Diploma thesis, Poltekkes KemenkesTanjungkarang.

RISTY ISNAINI, REVITA (2023) GAMBARAN PENGETAHUAN, KEBIASAAN SARAPAN PAGI, DAN STATUS GIZI PADA ANAK KELAS 5-6 DI SD N 2 KOTAGAJAH KABUPATEN LAMPUNG TENGAH TAHUN 2023. Diploma thesis, POLTEKKES KEMENKES TANJUNGKARANG.

RIZKI, M. AMANATA (2023) UJI EFEKTIVITAS ANTIBAKTERI EXTRA VIRGIN OLIVE OIL (EVOO) TERHADAP BAKTERI Streptococcus mutans ATCC 31987. Diploma thesis, Poltekkes KemenkesTanjungkarang.

RIZKY, LATANIYA AULIYA (2023) HUBUNGAN PERILAKU CARING PERAWAT DENGAN MOBILISASI DINI FASE TAKING IN PADA PASIEN POST OPERASI SECTIO CAESAREA DI RSIA RESTU BUNDA TAHUN 2023. Diploma thesis, Poltekkes Kemenkes Tanjungkarang.

RIZQIANI, SINTA (2023) FAKTOR-FAKTOR YANG BERHUBUNGAN DENGAN MOBILISASI DINI PADA PASIEN POST OPERASI DI RUANG BEDAH RSUD DR. H. ABDUL MOELOEK PROVINSI LAMPUNG TAHUN 2023. Diploma thesis, Poltekkes Kemenkes Tanjungkarang.

ROFIKA, ZULI (2023) GAMBARAN PENDERITA MALARIA BERDASARKAN JENIS PEKERJAAN DI PUSKESMAS MAJA KECAMATAN MARGA PUNDUH KABUPATEN PESAWARAN TAHUN 2022. Diploma thesis, Poltekkes KemenkesTanjungkarang.

ROMADHONA, NIKE (2023) ASUHAN KEPERAWATAN GANGGUAN KEBUTUHAN NUTRISI PADA PASIEN DIABETES MELITUS DI RUANG MELATI RUMAH SAKIT TK IV.02.07.04 KOTA BANDAR LAMPUNG TAHUN 2023. Diploma thesis, Poltekkes KemenkesTanjungkarang.

ROMANSYAH, RAMADAN RIDHO (2023) EFEKTIVITAS MENGUNYAH BUAH APEL DAN SEMANGKA TERHADAP PENURUNAN DEBRIS INDEKS PADA SISWA/I UMUR 10-12 TAHUN SDN 2 RAJABASA JAYA TAHUN 2023. Diploma thesis, Poltekkes Kemenkes Tanjungkarang.

ROSA, JHEVIA MEIDI (2023) GAMBARAN PENGGUNAAN TANAMAN OBAT KELUARGA (TOGA) UNTUK PENYAKIT KULIT PADA PETANI DI KECAMATAN BELALAU KABUPATEN LAMPUNG BARAT TAHUN 2023. Diploma thesis, Poltekkes KemenkesTanjungkarang.

ROSALIANTI, ANITA (2023) GAMBARAN PENGGUNAAN TANAMAN OBAT TRADISIONAL UNTUK MENGATASI DYSMENORRHEA DI DESA TAMAN SARI KECAMATAN GEDONG TATAAN KABUPATEN PESAWARAN PROVINSI LAMPUNG TAHUN 2023. Diploma thesis, Poltekkes KemenkesTanjungkarang.

ROSE, EVITA (2023) KEMAMPUAN MEDIA ALTERNATIF BEKATUL BERAS PUTIH (Oryza sativa l) TERHADAP PERTUMBUHAN JAMUR Candida albicans. Diploma thesis, Poltekkes Kemenkes Tanjungkarang.

ROSMALADEWI, NANI (2023) ASUHAN KEBIDANAN PADA IBU HAMIL DENGAN EMESIS GRAVIDARUM MENGGUNAKAN AROMATERAPI JERUK LEMON DI TPMB AFRIYANTI TULANG BAWANG BARAT. Diploma thesis, Poltekkes Tanjungkarang.

ROSYANA, SEPTI RIA (2023) GAMBARAN PENGETAHUAN, SIKAP DAN KEPATUHAN MENGONSUMSITABLET TAMBAH DARAH PADA REMAJA PUTRI DI SMP NEGERI 1 LIWA LAMPUNG BARAT. Diploma thesis, POLTEKKES KEMENKES TANJUNGKARANG.

ROZI, FAHRUL (2023) ASUHAN KEPERAWATAN PASIEN DENGAN GANGGUAN PERSEPSI SENSORI : HALUSINASI PENDENGARAN PADA KASUS SKIZOFRENIA PARANOID TERHADAP Tn. B DI RUANGAN NURI RUMAH SAKIT JIWA DAERAH PROVINSI LAMPUNG TANGGAL 7-9 MARET 2022. Diploma thesis, Poltekkes Kemenkes Tanjungkarang.

RUFAIDAH, INDRI (2023) ASUHAN KEPERAWATAN GANGGUAN KEBUTUHAN NYAMAN (NYERI) PADA PASIEN POST OPERASI TUMOR PAYUDARA DI RUANG MAWAR RUMAH SAKIT TK IV 02.07.04 DENKESYAH 02.04.03 BANDAR LAMPUNG TAHUN 2023. Diploma thesis, Poltekkes KemenkesTanjungkarang.

RUSANDI, VERA CAHYATI (2023) ASUHAN KEPERAWATAN GANGGUAN RASA NYAMAN PADA PASIEN POST HEMOROIDEKTOMI DENGAN INTERVENSI KOMPRES DINGIN DI RSUD ABDUL MOELEOK PROVINSI LAMPUNG TAHUN 2023. Diploma thesis, Poltekkes Kemenkes Tanjungkarang.

RUWAINI, DESTI (2023) EVALUASI PENGELOLAAN HYGIENE DAN SANITASI MAKANAN JAJANAN DI WILAYAH KERJA PUSKESMAS MARGOJADI KECAMATAN MESUJI TIMUR KABUPATEN MESUJI TAHUN 2022. Diploma thesis, Poltekkes Tanjungkarang.

Ramadhan, Ridha Amalia (2023) GAMBARAN PENGETAHUAN DAN SIKAP PERILAKU HIDUP BERSIH SEHAT PADA MAHASISWA POLITEKNIK KESEHATAN TANJUNGKARANG (KAMPUS A) TAHUN 2023. Diploma thesis, Poltekkes KemenkesTanjungkarang.

Ramadhoti, Novitasari (2023) PEMBUATAN GIGI TIRUAN SEBAGIAN LEPASAN AKRILIK RAHANG ATAS DAN RAHANG BAWAH DENGAN KASUS LINGGIR TAPERING DAN EKSTRUSI GIGI 16. Diploma thesis, Poltekkes KemenkesTanjungkarang.

Robiansyah, Septario Rahmandia (2023) PENYELENGGARAAN PENGENDALIAN VEKTOR KECOA PADA KAPAL FERRY DI PELABUHAN BAKAUHENI PROVINSI LAMPUNG TAHUN 2022. Diploma thesis, Poltekkes Tanjungkarang.

Rosalinda, Dhea (2023) ASUHAN KEPERAWATAN GANGGUAN KEBUTUHAN SIRKULASI PADA PASIEN ANEMIA DI RUANG PENYAKIT DALAM NON INFEKSIUS RSUD Dr. H. ABDUL MOELOEK PROVINSI LAMPUNG TAHUN 2023. Diploma thesis, Poltekkes KemenkesTanjungkarang.

S

SABILAH, DESI FITRIANA (2023) ASUHAN KEBIDANAN PADA BADUTA DENGAN KETERLAMBATAN ASPEK MOTORIK KASAR DAN BICARA SERTA BAHASA DI TPMB M TRIMURJO LAMPUNG TENGAH. Diploma thesis, Poltekkes Tanjungkarang.

SABRINA, BERTANIA (2023) ASUHAN KEPERAWATAN ANAK DENGAN GANGGUAN TERMOREGULASI PADA KASUS OBSERVASI FEBRIS TERHADAP AN. D DI RSU HANDAYANI KOTABUMI, KABUPATEN LAMPUNG UTARA TANGGAL 06-08 APRIL 2023. Diploma thesis, Poltekkes Kemenkes Tanjungkarang.

SADEWA, PANCA (2023) FAKTOR RESIKO PENDERITA TB PARU DI WILAYAH KERJA PUSKESMAS PANARAGAN JAYA KABUPATEN TULANG BAWANG BARAT PROVINSI LAMPUNG TAHUN 2023. Diploma thesis, POLTEKKES KEMENKES TANJUNGKARANG.

SADEWA, PANCA (2023) FAKTOR RESIKO PENDERITATB PARU DI WILAYAH KERJAPUSKESMAS PANARAGAN JAYA KABUPATEN TULANG BAWANG BARAT PROVINSI LAMPUNG TAHUN 2023. Diploma thesis, Poltekkes Kemenkes Tanjungkarang.

SADYAH, AYU RAHMADHANI (2023) PENGGUNAAN ALAT PELINDUNG DIRI (APD) PADA PEKERJA BAGIAN PRODUKSI DI PTPN VII UNIT USAHA WAY BERULU PESAWARAN TAHUN 2022. Diploma thesis, Poltekkes Tanjungkarang.

SAFIRA, INTAN (2023) GAMBARAN KONDISI RUMAH DENGAN KEJADIAN PENYAKIT TUBERKULOSIS (TB PARU) DI WILAYAH KEMILING KOTA BANDAR LAMPUNG TAHUN 2023. Diploma thesis, POLTEKKES KEMENKES TANJUNGKARANG.

SAFITRI, ANGGUN (2023) APLIKASI SOFTWARE SISTEM INTERNET OF THINGS (IoT) UNTUK ALAT SENSORIK PEMILAH PLASTIK. Diploma thesis, Poltekkes Tanjungkarang.

SAFITRI, AYU EKA (2023) GAMBARAN KEPUASANDAN SISA MAKANAN LUNAK PADA PASIEN RAWAT INAP KELAS III DI RSUD PRINGSEWU TAHUN 2023. Diploma thesis, POLTEKKES KEMENKES TANJUNGKARANG.

SAFITRI, DEVIA (2023) GAMBARAN PEMBELIAN, PENERIMAAN DAN PENYIMPANAN BAHAN MAKANAN DI RSUD BATIN MANGUNANG KAB. TANGGAMUS TAHUN 2023. Diploma thesis, Poltekkes Kemenkes Tanjungkarang.

SAFITRI, HESTI RAHMA (2023) PEMANFAATAN MINYAK JELANTAH DENGAN TAMBAHAN EKSTRAK DAUN CENGKIH (ZYZYGIUM AROMATICUM) SEBAGAI SABUN CAIR DALAM MENURUNKAN JUMLAH KUMAN PADA TELAPAK TANGA. Diploma thesis, Poltekkes Kemenkes Tanjung Karang.

SAFITRI, IRMA (2023) MANAJEMEN RISIKO PENGELOLAAN LIMBAH MEDIS PADAT DIRUMAH SAKIT KARTINI KALIREJO KABUPATEN LAMPUNG TENGAH TAHUN 2023. Diploma thesis, Poltekkes Kemenkes Tanjung Karang.

SAFITRI, NATASHA (2023) HUBUNGAN LAJU FILTRASI GLOMERULUS (LFG) DENGAN KADAR KALSIUM PADA PASIEN GAGAL GINJAL KRONIK DI RSUD Dr. H. ABDUL MOELOEK. Diploma thesis, Poltekkes KemenkesTanjungkarang.

SAFITRI, NIMAS (2023) ASUHAN KEPERAWATAN JIWA DENGAN PEMENUHAN KEBUTUHAN PSIKOSOSIAL GANGGUAN SENSORI PERSEPSI PADA PASIEN SKIZOFRENIA DI RUMAH SAKIT JIWA PROVINSI LAMPUNG TAHUN 2023. Diploma thesis, Poltekkes KemenkesTanjungkarang.

SAFITRI, NOVA (2023) ASUHAN KEPERAWATAN GANGGUAN KEBUTUHAN OKSIGENASI PADA PASIEN TUBERCULOSIS PARU DIRUANG PARU (E1) RSUD Dr. A. DADI TJOKRODIPO LAMPUNG LAMPUNG TAHUN 2023. Diploma thesis, Poltekkes KemenkesTanjungkarang.

SAFITRI, SAFITRI (2023) GAMBARAN KONDISI RUMAH DENGAN KEJADIAN PENDERITA PNEUMONIA PADA BALITA DI WILAYAH KERJA PUSKESMAS PENENGAHAN KABUPATEN LAMPUNG SELATAN TAHUN 2022. Diploma thesis, Poltekkes Tanjungkarang.

SAFITRI, YANA DWI (2023) PERENCANAAN SISTEM PENGELOLAAN SAMPAH DI DESA WISATA MERAK BELANTUNG KECAMATAN KALIANDA KABUPATEN LAMPUNG SELATAN TAHUN 2023. Diploma thesis, Poltekkes Kemenkes Tanjung Karang.

SAIMIN, SAIMIN (2023) PERBANDINGAN KUALITAS HASIL PEWARNAAN HEMATOXYLIN EOSIN DALAM PROSES DEPARAFINISASI DAN CLEARING AGENT MENGGUNAKAN MINYAK GANDAPURA (Gaultheria fragantissima) DENGAN XYLOL DI KLINIK MOROTAI PATOLOGI KOTA BANDAR LAMPUNG. Diploma thesis, Poltekkes Kemenkes Tanjungkarang.

SAKHI, PUTRI NAURA (2023) ASUHAN KEPERAWATAN GANGGUAN KEBUTUHAN AKTIVITAS ISTIRAHAT MOBILITAS FISIK PADA NY.S DENGAN POST PARTUM SECTIO CAESAREA DI RUMAH SAKIT DKT TK IV 02.07.04 KOTA BANDAR LAMPUNG TAHUN 2023. Diploma thesis, Poltekkes KemenkesTanjungkarang.

SALAMAH, UMMI (2023) PENGARUH KOMBINASI SPIRITUAL EMOTIONAL FREEDOM TECHNIQUE (SEFT) DAN RELAKSASI SLOW DEEP BREATHING TERHADAP SKALA NYERI PADA IBU POST OPERASI SECTIO CAESAREADI RSIA MUTIARA PUTRI PROVINSI LAMPUNG TAHUN 2023. Diploma thesis, Poltekkes Kemenkes Tanjungkarang.

SALIM, ZAM SALWA AZIZAH (2023) HUBUNGAN PERSEPSI BEBAN KERJA DENGAN KINERJA PERAWAT DI RUANG BEDAH RSUD DR. H. ABDUL MOELOEK PROVINSI LAMPUNG TAHUN 2023. Diploma thesis, Poltekkes KemenkesTanjungkarang.

SALIM, ZAM SALWA AZIZAH (2023) HUBUNGAN PERSEPSI BEBAN KERJA DENGAN KINERJA PERAWAT DI RUANG BEDAH RSUD DR. H. ABDUL MOELOEK PROVINSI LAMPUNG TAHUN 2023. Diploma thesis, Poltekkes KemenkesTanjungkarang.

SALIM, ZAM SALWA AZIZAH (2023) HUBUNGAN PERSEPSI BEBAN KERJA DENGAN KINERJA PERAWAT DI RUANG BEDAH RSUD DR. H. ABDUL MOELOEK PROVINSI LAMPUNG TAHUN 2023. Diploma thesis, Poltekkes KemenkesTanjungkarang.

SALIM, ZAM SALWA AZIZAH (2023) ZAM SALWA AZIZAH SALIM 1914301024. Diploma thesis, Poltekkes KemenkesTanjungkarang.

SALSABELA, PUTRI ALIVIA (2023) ASUHAN KEPERAWATAN PASIEN DENGAN RESIKO PERILAKU KEKERASAN PADA KASUS SKIZOFRENIA TERHADAP Tn.R DI RUANG NURI RUMAH SAKIT JIWA DAERAH PROVINSI LAMPUNG TANGGAL 14-16 MARET 2022. Diploma thesis, Poltekkes Kemenkes Tanjungkarang.

SALSABELLA, YUZA HAURA (2023) HUBUNGAN LAMA KERJA PERAWAT TERHADAP KEJADIAN LOW BACK PAIN DI RUANG BEDAH RUMAH SAKIT UMUM DAERAH Dr. Hi. ABDUL MOELOEK PROVINSI LAMPUNG TAHUN 2023. Diploma thesis, Poltekkes KemenkesTanjungkarang.

SALSABILA, ANGELINA NUR (2023) GAMBARAN JENIS MAKANAN JAJANAN, PERILAKU PEMILIHAN MAKANAN DAN STATUS GIZI SISWA SDN 1METRO PUSAT KOTA METRO TAHUN 2023. Diploma thesis, POLTEKKES KEMENKES TANJUNGKARANG.

SALSABILA, HENDITA INTAN (2023) HUBUNGAN KONDISI SARANA SANITASI DASAR DENGAN KEJADIAN DIARE DI KELURAHAN KOTAGAJAH KABUPATENLAMPUNG TENGAH TAHUN 2023. Diploma thesis, POLTEKKES KEMENKES TANJUNGKARANG.

SALSABILA, SALSABILA (2023) HUBUNGAN PERILAKU HIDUP BERSIH DAN SEHAT (PHBS) DENGAN KEJADIAN DIARE PADA BALITA DI WILAYAH KERJA PUSKESMAS WONOGIRI KECAMATAN KOTABUMI SELATAN KABUPATEN LAMPUNG UTARA TAHUN 2023. Diploma thesis, Poltekkes Tanjungkarang.

SALSABILA, WIDYASTUTI NUR (2023) PENGOLAHAN SAMPAH ORGANIK DENGAN LARVA BLACK SOLDIER FLY TAHUN 2022. Diploma thesis, Poltekkes Tanjungkarang.

SALSABILA DWI, FARAHDILLA (2023) GAMBARAN PENGETAHUAN DAN SIKAP SERTA DUKUNGAN GURU DALAM MENGONSUMSI TABLET FE PADA REMAJA PUTRI DI MTS NURUL HUDA KABUPATEN PRINGSEWU. Diploma thesis, POLTEKKES KEMENKES TANJUNGKARANG.

SALSABILLA, ANANDA ZAHRA (2023) GAMBARAN KADAR HEMOGLOBIN DAN FERITIN PADA PENDERITA THALASEMIA MAYOR (SPLENEKTOMI DAN NON-SPLENEKTOMI) DI RSUD Dr. H. ABDUL MOELOEK PROVINSI LAMPUNG TAHUN 2018-2022. Diploma thesis, Poltekkes KemenkesTanjungkarang.

SANI, DIAN ANIS (2023) HUBUNGAN KEMAMPUAN OTONOMI PASIEN DENGAN METODE PEMBERIAN INFORMED CONSENT PADA PASIEN OPERASI ELEKTIF DI RUANG RAWAT INAP BEDAH RSUD Dr. H. ABDUL MOELOEK PROVINSI LAMPUNG TAHUN 2023. Diploma thesis, Poltekkes KemenkesTanjungkarang.

SANJAYA, ROBBY (2023) GAMBARANSARANASANITASI SEKOLAH DASAR NEGERI DI WILAYAH PUSKESMASKOTABUMI II KECAMATAN KOTABUMI SELATANKABUPATENLAMPUNGUTARA TAHUN2021/2022. Diploma thesis, POLTEKKES KEMENKES TANJUNGKARANG.

SANTIKA, EVA (2023) ASUHAN KEPERAWATAN PASIEN DENGAN GANGGUAN RASA AMAN NYAMAN PADA KASUS POST SECTIO CAESAREA TERHADAP Ny.M DIRUANG KEBIDANAN RSU HANDAYANI KOTABUMI KABUPATEN LAMPUNG UTARA TANGGAL 27-29 MARET 2023. Diploma thesis, Poltekkes Kemenkes Tanjungkarang.

SAPITRI, AGNES MEILIANA (2023) ASUHAN KEPERAWATAN GERONTIK DENGAN GANGGUAN OKSIGENASI TERHADAP TN.S PADA KASUS ASMA DI DESA KOTA ALAM KEC.KOTABUMI SELATAN KAB.LAMPUNG UTARA TANGGAL 16-18MARET 2023. Diploma thesis, Poltekkes Kemenkes Tanjungkarang.

SAPITRI, PRAMUDITA (2023) Gambaran Faktor Personal Hygiene Dan Sanitasi Lingkungan Rumah Penderita Pytiriasis Versicolor (Panu) di Wilayah Kerja Puskesmas Ngarip Kabupaten Tanggamus Tahun 2022. Diploma thesis, POLTEKKES KEMENKES TANJUNGKARANG.

SAPUTRA, ANGGA DWI (2023) GAMBARAN PENGETAHUAN DAN SIKAP MASYARAKAT DESA KOTAGAJAH KECAMATAN KOTA GAJAH TERHADAP ALUR PEMBUATAN GIGI TIRUAN TAHUN 2023. Diploma thesis, Poltekkes KemenkesTanjungkarang.

SAPUTRA, DEDY JAYA (2023) ASUHAN KEPERAWATAN PASIEN DENGAN GANGGUAN AKTIVITAS DAN ISTIRAHAT PADA KASUS STROKE NON HEMORAGIK TERHADAP Tn. S DI RUANG FREESIA RSU HANDAYANI KOTABUMI LAMPUNG UTARA 10-13 OKTOBER 2022. Diploma thesis, Poltekkes Kemenkes Tanjungkarang.

SAPUTRA, HANIF ANDALAS (2023) ASUHAN KEPERAWATAN GANGGUAN KEBUTUHAN NUTRISI PADA PASIEN THYPOID DI RUMAH SAKIT BHAYANGKARA POLDA LAMPUNG TAHUN 2023. Diploma thesis, Poltekkes KemenkesTanjungkarang.

SAPUTRA, KURNIA AHMAD (2023) ASUHAN KEPERAWATAN GANGGUAN KEBUTUHAN TERMOREGULASI PADA PASIEN HIPERTERMIA DI RUANG ALAMANDA RSUD DR. H. ABDUL MOELOEK PROVINSI LAMPUNG TAHUN 2023. Diploma thesis, Poltekkes KemenkesTanjungkarang.

SAPUTRA, MUHAMMAT IRVAN (2023) PENGARUH AIR REBUSAN KULIT KAYU MANIS (Cinnamomum verum) TERHADAP KUALITAS MIKROBIOLOGIS SUSU SEGAR KAMBING ETAWA. Diploma thesis, Poltekkes Kemenkes Tanjungkarang.

SAPUTRI, ANISA NADA (2023) ASUHAN KEPERAWATAN GANGGUAN KEBUTUHAN ISTIRAHAT DAN TIDUR PADA KLIEN ABLASIO RETINA DAN HIPERTENSI DI DUSUN SRIMULYO I PEMANGILAN NATAR LAMPUNG SELATAN TAHUN 2023. Diploma thesis, Poltekkes KemenkesTanjungkarang.

SAPUTRI, CORNELIA A (2023) ASUHAN KEPERAWATAN PASIEN DENGAN GANGGUAN MOBILITAS FISIK PADA KASUS POST SECTIO CAESAREA TERHADAP NY.A DI RUANG KEBIDANAN RSU HANDAYANI KOTABUMI LAMPUNG UTARA TANGGAL 29-31 MARET 2023. Diploma thesis, Poltekkes Kemenkes Tanjungkarang.

SAPUTRI, ELGALENIA MARTHA (2023) ASUHAN KEPERAWATAN GANGGUAN KEBUTUHAN SIRKULASI PADA PASIEN DENGAN ANEMIA DI RUANG PENYAKIT DALAM RSUD Dr. A. DADI TJOKRODIPO KOTA BANDAR LAMPUNG TAHUN 2023. Diploma thesis, Poltekkes KemenkesTanjungkarang.

SAPUTRI, INDAH (2023) ASUHAN KEPERAWATAN KELUARGA DENGAN GANGGUAN AKTIVITAS PADA KASUS STROKE TERHADAP TN. J DI WILAYAH KERJA PUSKESMAS KOTABUMI II KABUPATEN LAMPUNG UTARA TANGGAL 27-29 MARET 2023. Diploma thesis, Poltekkes Kemenkes Tanjungkarang.

SAPUTRI, NI MADE WIDYA (2023) ASUHAN KEBIDANAN KESEHATAN REPRODUKSI PADA Nn.N USIA 17 TAHUN DENGAN DISMENORE PRIMER DI TEMPAT PRAKTIK MANDIRI BIDAN ESSY NOVIA KARTARAHARJA KABUPATEN TULANG BAWANG BARAT. Diploma thesis, Poltekkes Tanjungkarang.

SARI, ADEK YUNITA (2023) ASUHAN KEPERAWATANNYERI AKUT DENGAN PENERAPAN SLOW DEEP BREATHING PADA PASIEN POST OP HEMORRHOIDECTOMY DI RSUDDr. H ABDUL MOELOEK PROVINSI LAMPUNG TAHUN 2023. Diploma thesis, Poltekkes Kemenkes Tanjungkarang.

SARI, AULIA PERMATA (2023) FORMULASI LIP CREAM EKSTRAK BUNGA KECOMBRANG (Etlingera elatior (Jack) R.M.Sm) SEBAGAI PEWARNA ALAMI. Diploma thesis, Poltekkes KemenkesTanjungkarang.

SARI, AULIA PERMATA (2023) PENETAPAN KADAR VITAMIN C PADA KULIT PISANG MULI (Musa acuminata Linn.) DENGAN METODE SPEKTROFOTOMETRI UV-VIS. Diploma thesis, Poltekkes KemenkesTanjungkarang.

SARI, DESFITA (2023) PEMBERIAN PUTIH TELUR REBUS TERHADAP PERCEPATAN PENYEMBUHAN LUKA PERINEUM PADA IBU NIFAS TERHADAP NY.N P1A0 DI PMB ELFI YANTI, S.Tr.Keb LAMPUNG SELATAN. Diploma thesis, Poltekkes Kemenkes Tanjungkarang.

SARI, DEVA NADA LIANA (2023) FAKTOR-FAKTOR YANG BERHUBUNGAN DENGAN TINGKAT NYERI PADA PASIEN POST OPERASI ELEKTIF DI RUANG RAWAT INAP BEDAH RSUD Dr. H. ABDUL MOELOEK PROVINSI LAMPUNG TAHUN 2023. Diploma thesis, Poltekkes Kemenkes Tanjungkarang.

SARI, DEVA OKTAVIA (2023) ASUHAN KEPERAWATAN GANGGUAN OKSIGENASI PADA KASUS STROKE NON HEMORAGIC (SNH) TERHADAP NY. T DI RUANG FREESIA RSU HANDAYANI KOTABUMI LAMPUNG UTARA TANGGAL 17-19 OKTOBER 2022. Diploma thesis, Poltekkes Kemenkes Tanjungkarang.

SARI, DINDA PERMATA (2023) GAMBARAN FAKTOR EKSTERNAL DAN DAYA TERIMA MAKANAN DI ASRAMA PUTRI MUSLIMAT PONDOK PESANTREN ALFATAH NATAR. Diploma thesis, POLTEKKES KEMENKES TANJUNGKARANG.

SARI, FIFI NANDA (2023) ASUHAN KEPERAWATAN GANGGUAN KEBUTUHAN RASA NYAMAN PADA PASIEN HIPERTENSI DI RUANG KELAS 2,3 RUMAH SAKIT BHAYANGKARA POLDA LAMPUNG TAHUN 2023. Diploma thesis, Poltekkes Tanjungkarang.

SARI, ISMA YUNITA (2023) HUBUNGAN KUALITAS PELAYANAN KESEHATAN DENGAN TINGKAT KEPUASAN PASIEN POST OPERASI DI RS YUKUM MEDICAL CENTRE LAMPUNG TENGAH TAHUN 2023. Diploma thesis, Poltekkes Kemenkes Tanjungkarang.

SARI, LIDIA LIA (2023) GAMBARAN ANALISIS BIAYA BAHAN MAKANAN DI RUMAH SAKIT UMUM DAERAH ALIMUDDIN UMAR LAMPUNG BARAT TAHUN 2023. Diploma thesis, POLTEKES KEMENKES TANJUNGKARANG.

SARI, MAILINA (2023) GAMBARAN PERILAKU PENDERITA PENYAKIT HIV/AIDS DI WILAYAH KERJA PUSKESMAS RAWAT INAP WAY KANDIS KOTA BANDAR LAMPUNG TAHUN 2022. Diploma thesis, POLTEKKES KEMENKES TANJUNGKARANG.

SARI, MALA (2023) PENGARUH RELAKSASI AUTOGENIKTERHADAP KECEMASAN PASIENPRE OPERATIF KANKER PAYUDARADI RSUD Dr. H. ABDUL MOELOEKPROVINSI LAMPUNG. Diploma thesis, Poltekkes Kemenkes Tanjungkarang.

SARI, NESYA LIANA (2023) GAMBARAN JUMLAH TROMBOSIT DAN INDEKS TROMBOSIT PADA PASIEN INFEKSI DENGUE PRIMER DAN SEKUNDER DI RSUD Dr. A. DADI TJOKRODIPO TAHUN 2022. Diploma thesis, Poltekkes KemenkesTanjungkarang.

SARI, NOVITA (2023) ASUHAN KEBIDANAN PADA IBU NIFAS DENGAN BENDUNGAN ASI DI TEMPAT PRAKTIK MANDIRI ESSY NOVIA TULANG BAWANG BARAT. Diploma thesis, Poltekkes Tanjungkarang.

SARI, PUTRI KURNIA (2023) PENERAPAN MODERN DRESSING PADA PASIEN POST DEBRIDEMEN ULKUS DIABETIKUM DI RUMAH SAKIT MARDI WALUYO KOTA METRO, LAMPUNG TAHUN 2023. Diploma thesis, Poltekkes Kemenkes Tanjungkarang.

SARI, RAFIKA MAYANG (2023) FAKTOR RISIKO KONDISI FISIK RUMAH DENGAN PENDERITA TUBERKULOSIS PARU DI WILAYAH KERJA PUSKESMAS SEGALA MIDER KECAMATAN LANGKAPURA KOTA BANDAR LAMPUNG TAHUN 2023. Diploma thesis, Poltekkes Kemenkes Tanjung Karang.

SARI, RANNY AFLIA (2023) ASUHAN KEPERAWATAN PASIEN DENGAN GANGGUAN RASA NYAMAN PADA KASUS POST SECTIO CAESAREA TERHADAP Ny.V DI RUANG KEBIDANAN RSU HANDAYANI KOTABUMI LAMPUNG UTARA TANGGAL 28-30 MARET 2023. Diploma thesis, Poltekkes Kemenkes Tanjungkarang.

SARI, SATRIA PRIMA (2023) GAMBARAN JUMLAH LEUKOSIT DAN TROMBOSIT ANTAR SKALA KEPOSITIFAN TUBEX PADA PENDERITA DEMAM TIFOID DI RUMAH SAKIT MITRA HUSADA PRINGSEWU TAHUN 2022. Diploma thesis, Poltekkes KemenkesTanjungkarang.

SARI, SUCI PERMATA (2023) GAMBARAN PENGETAHUAN, SIKAP, DAN PERILAKU HIGIENE SANITASI PADA PENGOLAH MAKANAN DI RSUD ALIMUDDIN UMAR LAMPUNG BARAT. Diploma thesis, POLTEKKES KEMENKES TANJUNGKARANG.

SARI, TIA KUMALA (2023) GAMBARAN RUMAH SEHAT PADA PENDERITA TUBERKULOSIS PARU DI WILAYAH KERJA PUSKESMAS RAWAT INAP WAY KANDIS KOTA BANDAR LAMPUNG TAHUN 2022. Diploma thesis, Poltekkes Tanjungkarang.

SARI, YUNI PURNAMA (2023) ASUHAN KEPERAWATAN GANGGUAN KEBUTUHAN OKSIGEN PADA PASIEN STROKE DI RUANG ICU RSUD Dr. H. ABDUL MOELOEK TAHUN 2023. Diploma thesis, Poltekkes KemenkesTanjungkarang.

SARI, YUSTIKA DAMA (2023) GAMBARAN PENDERITA PENYAKIT GASTRITIS KRONIS DI KELURAHAN KURIPAN PUSKESMAS KOTAAGUNG KABUPATEN TANGGAMUS TAHUN 2022. Diploma thesis, POLTEKKES KEMENKES TANJUNGKARANG.

SAVENDRA, DIKI (2023) SISTEM PENGELOLAAN LIMBAH MEDIS B3 DI PUSKESMAS RAWAT INAP KEDATON TAHUN 2023. Diploma thesis, Poltekkes Kemenkes Tanjung Karang.

SAVITRI, NOVI (2023) ASUHAN KEBIDANAN PADA IBU HAMIL DENGAN ANEMIA DI TPMB SITI WASIRAH LAMBU KIBANG TULANG BAWANG BARAT. Diploma thesis, Poltekkes Tanjungkarang.

SAVITRI, VIONI HANERA (2023) FAKTOR-FAKTOR YANG MEMPENGARUHI KECEMASAN PADA PASIEN PRE OPERASI DI RUANG BEDAH RSUD DR. H. ABDUL MOELOEK PROVINSI LAMPUNG TAHUN 2023. Diploma thesis, Poltekkes Kemenkes Tanjungkarang.

SAYIDINA, KENSASSA (2023) KAJIAN PEMBUATAN COOKIES KISMIS SUBSITUSI TEPUNG OATMEAL SEBAGAI ALTERNATIF CEMILAN PADA PASIEN JANTUNG. Diploma thesis, Poltekkes KemenkesTanjungkarang.

SELVIANA, MUTIARA RINI (2023) PENATALAKSANAAN PEMBERIAN SARI KACANG HIJAU PADA IBU HAMIL TRIMESTER III DENGAN ANEMIA RINGAN TERHADAP NY.N DI PMB NURHIDAYAH LAMPUNG SELATAN. Diploma thesis, Poltekkes Tanjungkarang.

SEPTIANA, DIAH AYU (2023) Pengolahan Sampah Organik Pada Level Rumah Tangga Menggunakan Metode Larva Black Soldier Fly (BSF). Diploma thesis, POLTEKKES KEMENKES TANJUNGKARANG.

SEPTIANA, EMILIA ADELINE CLARA (2023) ASUHAN KEPERAWATAN GANGGUAN KEBUTUHAN NUTRISI PADA KLIEN GASTRITIS DI DESA PEMANGGILAN KECAMATAN NATAR LAMPUNG SELATAN TAHUN 2023. Diploma thesis, Poltekkes KemenkesTanjungkarang.

SEPTIANA, NOVI ANDIKA (2023) GAMBARAN FAKTOR PERSONAL HYGIENE DAN SANITASI LINGKUNGAN PENDERITA DERMATITIS KONTAK DI WILAYAH KERJA PUSKESMAS KENALI KABUPATEN LAMPUNG BARAT TAHUN 2023. Diploma thesis, POLTEKKES KEMENKES TANJUNGKARANG.

SEPTIANDA, ALINTA (2023) PERBEDAAN KADAR UREUM DAN ASAM URAT SEBELUM DAN SESUDAH MENGKONSUMSI OBAT ANTI TUBERCULOSIS (OAT) AKHIR FASE INTENSIF PADA PASIEN TUBERCULOSIS PARU. Diploma thesis, Poltekkes Kemenkes Tanjungkarang.

SEPTIANI, DIA (2023) HUBUNGAN PENGETAHUANSISWA TENTANG PENAMBALAN TERHADAP NILAI PTI KELAS IV DAN V SD N 1 RAJABASA TAHUN 2023. Diploma thesis, Poltekkes Kemenkes Tanjungkarang.

SETIA WATI, PUSPITA (2023) GAMBARAN BIAYA MAKAN, STANDAR RESEP DAN STANDAR PORSI DI PONDOK PESANTREN AL HIKMAH BANDAR LAMPUNG TAHUN 2023. Diploma thesis, Poltekkes KemenkesTanjungkarang.

SETIANI, DIANA (2023) ASUHAN KEPERAWATAN PASIEN DENGAN GANGGUAN KEBUTUHAN SIRKULASI PADA PERDARAHAN POSTPARTUM TERHADAP NY. H DI RUANG KEBIDANAN RUMAH SAKIT UMUM HANDAYANI LAMPUNG UTARA PADA TANGGAL 29-31 MARET 2023. Diploma thesis, Poltekkes Kemenkes Tanjungkarang.

SETIANI, FINA (2023) GAMBARAN PERENCANAAN MENU DAN CITA RASA MAKANAN BIASA PASIEN RAWAT INAP DI RSUD DEMANG SEPULAU RAYA LAMPUNG TENGAH TAHUN 2023. Diploma thesis, POLTEKKES KEMENKES TANJUNGKARANG.

SETIAWAN, AJENG ANDINI (2023) PENATALAKSANAAN ASUHAN GIZI TERSTANDAR PADA PASIEN JANTUNG KORONER RAWAT INAP DI RUMAH SAKIT UMUM ABDUL MOELOEK BANDAR LAMPUNG. Diploma thesis, POLTEKKES KEMENKES TANJUNGKARANG.

SETIAWAN, FAISAL AJI (2023) ASUHAN KEPERAWATAN POST PARTUM SECTIO CAESAREA GANGGUAN NYERI AKUT DENGAN INTERVENSI RELAKSASI BENSON DI RSUD JENDRAL AHMAD YANIKOTA METRO TAHUN 2023. Diploma thesis, Poltekkes Kemenkes Tanjungkarang.

SHAFIRA, TRIANTIKA (2023) HUBUNGAN DERAJAT KEPOSITIFAN BASIL TAHAN ASAM (BTA) TERHADAP PROFIL HEMATOLOGI DAN NLR PADA PASIEN TUBERKULOSIS PADA BEBERAPA PUSKESMAS KOTA BANDAR LAMPUNG. Diploma thesis, Poltekkes Kemenkes Tanjungkarang.

SHALSABILLA, ALYSHA ARUM (2023) ASUHAN KEBIDANAN PADA PERSALINAN DENGAN PENGURANGAN NYERI KALA 1 FASE AKTIF DI TPMB MAWAR EKA SARI TRIMURJO. Diploma thesis, Poltekkes Tanjungkarang.

SHANTY, NI MADE MELLA (2023) GAMBARAN PENGETAHUAN, SIKAP DAN PERILAKU PENJAMAH MAKANAN TENTANG HYGIENE SANITASI PADA PENYELENGGARAAN MAKANAN RS IMANUEL BANDAR LAMPUNG TAHUN 2023. Diploma thesis, Poltekkes KemenkesTanjungkarang.

SHINTIA, IVANA DWI (2023) UJI EFEKTIVITAS EKSTRAK DAUN MENGKUDU (Morinda citrifolia L.) DALAM MEMATIKAN LALAT RUMAH (Musca domestica). Diploma thesis, Poltekkes Kemenkes Tanjung Karang.

SHOFA, HANIFAH NUR (2023) UJI KEMAMPUAN LILIN AROMATERAPI CENGKEH (Syzygium Aromaticum) DALAM MENGUSIR LALAT RUMAH (Musca Domestica). Diploma thesis, POLTEKKES KEMENKES TANJUNGKARANG.

SHOLAH AMRAN, AGUS (2023) GAMBARAN PENGELOLAAN LIMBAH MEDIS RUMAH SAKIT UMUM DAERAH ABDUL MOELOEK PROVINSI BANDAR LAMPUNG. Diploma thesis, POLTEKKES KEMENKES TANJUNGKARANG.

SHOLEH, IKA WADIF AZIZAH (2023) ASUHAN KEPERAWATANGANGGUAN KEBUTUHAN AMAN NYAMAN PADA PASIEN SINUSITIS MAKSILARIS DI RUMAH SAKIT BHAYANGKARA POLDA LAMPUNG TAHUN 2023. Diploma thesis, Poltekkes KemenkesTanjungkarang.

SIMATUPANG, DONNI (2023) ASUHAN KEBIDANAN PADA BALITA DENGAN DEMAM DI TPMB KISWARI, A.MD. KEB KOTA METRO. Diploma thesis, Poltekkes Tanjungkarang.

SINANSARI, DILLA (2023) HUBUNGAN DERAJAT POSITIVITAS BASIL TAHAN ASAM DENGAN KEBERADAAN GRANULA TOKSIK PADA PENDERITA TUBERKULOSIS PARU DI PUSKESMAS PANJANG KOTA BANDAR LAMPUNG TAHUN 2020. Diploma thesis, Poltekkes Kemenkes Tanjungkarang.

SINDY CANTIKA, VALENTINA (2023) PEMBERIAN SARI KACANG HIJAU UNTUK MEMPERBANYAK PRODUKSI ASI PADA IBU NIFAS TERHADAP NY. N DI PMB EMALIA, SKM. Diploma thesis, Poltekkes Kemenkes Tanjungkarang.

SINTA ARLINDA, MAY (2023) GAMBARAN PENGOLAHAN SAMPAH DI PASAR PURWODADI SIMPANG TANJUNG BINTANG KABUPATEN LAMPUNG SELATAN TAHUN 2023. Diploma thesis, POLTEKKES KEMENKES TANJUNGKARANG.

SINTIYA, IRA (2023) ASUHAN KEBIDANAN KEHAMILAN TERHADAP Ny. L DENGAN EMESIS GRAVIDARUM DI TEMPAT PRAKTIK MANDIRI BIDAN D TULANG BAWANG BARAT. Diploma thesis, Poltekkes Tanjungkarang.

SIPA, SALVIA SALSABILA (2023) GAMBARAN STATUS GIZI, ASUPAN ENERGI, ASUPAN ZAT GIZI MAKRO, AKTIFITAS FISIK DAN PENGETAHUAN GIZI SISWASMP ADVENT BANDAR LAMPUNG TAHUN 2023. Diploma thesis, POLTEKKES KEMENKES TANJUNGKARANG.

SIRAIT, ANGGI (2023) GAMBARAN ASUPAN NATRIUM, KALIUM, RIWAYAT KELUARGA DAN KEBIASAAN MEROKOK PADA PENDERITA HIPERTENSI DI PUSKESMAS KETAPANG KECAMATAN SUNGKAI SELATAN KABUPATEN LAMPUNG UTARA TAHUN 2023. Diploma thesis, Poltekkes KemenkesTanjungkarang.

SIRRY, SAZAYA FADWA (2023) GAMBARAN PERSONAL HYGIENE PADA PENDERITA SCABIES DI WILAYAH KERJA PUSKESMAS KALIREJO KABUPATEN PESAWARAN TAHUN 2023. Diploma thesis, POLTEKKES KEMENKES TANJUNGKARANG.

SOLEHA, SYADZA (2023) UJI EFEKTIVITAS EKSTRAK BUNGA TELANG (Clitoria ternatea) TERHADAP DAYA HAMBAT JAMUR Candida albicans. Diploma thesis, Poltekkes Kemenkes Tanjungkarang.

SOPIA, NIDA (2023) GAMBARAN TINGKAT KECEMASAN PASIEN ANAK PADA SAAT DILAKUKAN PENCABUTANGIGI DI BPG PUSKESMAS KRUI PESISIR BARAT. Diploma thesis, Poltekkes Kemenkes Tanjungkarang.

SORAYA, DHEA (2023) PERBANDINGAN PENYULUHAN MEDIA BONEKA TANGAN DAN POSTER TERHADAP PERILAKU PEMELIHARAAN KESEHATAN GIGI SISWA/I KELAS II SDN 1 KAMPUNG BARU TAHUN 2023. Diploma thesis, Poltekkes Kemenkes Tanjungkarang.

SUBAKTI, TARISSA DEVINDA VRISCA AYU (2023) GAMBARAN PENYAJIAN MAKANAN BIASA PADA PASIEN RAWAT INAP KELAS II DI RUMAH SAKIT DKT BANDAR LAMPUNG TAHUN 2023. Diploma thesis, Poltekkes KemenkesTanjungkarang.

SUJONO, AJENG WILUJENG (2023) GAMBARAN PELAKSANAAN KONSELING OBAT OLEH APOTEKER DI APOTEK WILAYAH KOTA BANDAR LAMPUNG TAHUN 2023. Diploma thesis, Poltekkes KemenkesTanjungkarang.

SUKMA, DITHA MIRANDA (2023) ASUHAN KEPERAWATAN GANGGUAN KEBUTUHAN OKSIGENASI PADA KASUS BRONKIEKTASIS TERHADAP NY.T DIRUANGAN PARU DI RSUD MAYJEND HM RYACUDU LAMPUNG UTARA PADA TANGGAL 12-14 OKTOBER 2022. Diploma thesis, Poltekkes Kemenkes Tanjungkarang.

SUKMA, MEGA MELATI (2023) ASUHAN KEPERAWATAN GANGGUAN KEBUTUHAN RASA NYAMAN PADA PASIEN POST PARTUM SPONTAN DENGAN KASUS KETUBAN PECAH DINI DI RUANG DELIMA RSUD.Dr. ABDUL MOELOEK PROVINSI LAMPUNG TAHUN 2023. Diploma thesis, Poltekkes KemenkesTanjungkarang.

SULISTYANINGSIH, MUSTHIKA HANUM (2023) ASUHAN KEBIDANAN PADA BAYI BARU LAHIR DENGAN IKTERUS DI TPMB ROSMIANAH KEC TULANG BAWANG UDIK TULANG BAWANG BARAT. Diploma thesis, Poltekkes Tanjungkarang.

SULISTYASIH, NILUH (2023) GAMBARAN KEBERHASILAN PENYULUHAN MENGGUNAKAN MEDIA AUDIOVISUAL TERHADAP KEBERSIHAN GIGI DAN MULUT PADA ANAK TUNAGRAHITA DI SDLBN PKK PROVINSI LAMPUNG TAHUN 2023. Diploma thesis, Poltekkes Kemenkes Tanjungkarang.

SUPRAYOGI, HERI (2023) ASUHAN KEPERAWATAN NYERI AKUT PADA PASIEN POST OP HERNIOTOMI DENGAN INTERVENSI RELAKSASI GENGGAM JARI DI RUMAH SAKIT BHAYANGKARA POLDA LAMPUNG TAHUN 2023. Diploma thesis, Poltekkes Kemenkes Tanjungkarang.

SURAHMAN, AKBAR (2023) ASUHAN KEPERAWATAN PASIEN DENGAN GANGGUAN RASA AMAN NYAMAN PADA KASUS COMBUSTIO TERHADAP Tn. S DI RUANG BEDAH RSUD MAYJEND HM. RYACUDU KOTABUMI LAMPUNG UTARA TANGGAL 21-24 NOVEMBER 2022. Diploma thesis, Poltekkes Kemenkes Tanjungkarang.

SURI, DEVI DIANA (2023) ASUHAN KEPERAWATAN GANGGUAN NYERI AKUT DENGAN INTERVENSI TEKNIK RELAKSASI NAPAS DALAM DAN TERAPI MUROTTAL PADA PASIEN POST PARTUM SECTIO CAESARIA DI RSUD dr Hi ABDUL MOELOEK PROVINSI LAMPUNG TAHUN 2023. Diploma thesis, Poltekkes Kemenkes Tanjungkarang.

SURYA, ANADYA (2023) ASUHAN KEPERAWATAN GANGGUAN KEBUTUHAN FISIOLOGIS SUBKATEGORI NEUROSENSORI DAN SIRKULASI PADA PASIEN STROKE INFARK DAN INTRACEREBRAL HEMORRHAGE (ICH) DI RUANG BOUGENVILE RSUD Dr.H. ABDUL MOELOEK PROVINSI LAMPUNG TAHUN 2023. Diploma thesis, Poltekkes KemenkesTanjungkarang.

SURYATI, IMELDA DEWI (2023) FORMULASI DAN EVALUASI SABUN PADAT TRANSPARAN ANTI JERAWAT EKSTRAK BIJI PINANG (Areca catechu L). Diploma thesis, Poltekkes KemenkesTanjungkarang.

SUSANTI, SUSI (2023) PENERAPAN TERAPI RELAKSASI NAFAS DALAM PADA PASIEN CERVICAL SPONDYLOTIC MYELOPATHY POST LAMINECTOMY DENGAN MASALAH NYERI AKUT DI RSUD AHMAD YANI KOTA METRO TAHUN 2023. Diploma thesis, Poltekkes Kemenkes Tanjungkarang.

SUSELA, LAVITA MARINA (2023) GAMBARAN PELAKSANAAN DAGUSIBU OBAT PADA MASYARAKAT DI DESA KENALI KECAMATAN BELALAU KABUPATEN LAMPUNG BARAT. Diploma thesis, Poltekkes KemenkesTanjungkarang.

SUSILAWATI, YUNI (2023) ASUHAN KEPERAWATAN PASIENDENGANGANGGUANKEBUTUHAN AKTIVITAS ISTIRAHAT PADA KASUS POST SECTIO CAESAREA TERHADAP Ny. O DI RUANG KEBIDANAN RSU HANDAYANI KOTABUMILAMPUNG UTARA TANGGAL 21-23 MARET TAHUN 2023. Diploma thesis, Poltekkes Kemenkes Tanjungkarang.

SUTRISNAWATI, KETUT (2023) ASUHAN KEPERAWATAN GANGGUAN KEBUTUHAN RASA AMAN NYAMAN (NYERI ) PADA PASIEN COLIC ABDOMEN DI RUANG MELATI RUMAH SAKIT DKT DENKENSYAH BANDAR LAMPUNG TAHUN 2023. Diploma thesis, Poltekkes KemenkesTanjungkarang.

SUWOYO, NADIYAH (2023) PENGARUH TERAPI HOT PACK SUPRAPUBIK TERHADAP PEMULIHAN REFLEK VESIKA URINIA POST ANESTESI SPINAL DI RSUD Dr. H. ABDUL MOELOEK TAHUN 2023. Diploma thesis, Poltekkes Kemenkes Tanjungkarang.

SYAFITRA, RYO (2023) GAMBARAN DENSITAS JENTIK NYAMUK AEDES AEGYPTI DITINJAU DARI HOUSE INDEX (HI) DI KELURAHAN SUKABUMI KECAMATAN SUKABUMI KOTA BANDAR LAMPUNG TAHUN 2023. Diploma thesis, POLTEKKES KEMENKES TANJUNGKARANG.

SYAHIDAH, SYARI MUTYARA (2023) PENGARUH TERAPI MUSIK INTRUMENTAL DAN EYE MASK TERHADAP KUALITAS TIDUR PASIEN PRE OPERASI DI RSUD Dr. H. ABDUL MOELOEK PROVINSI LAMPUNG TAHUN 2023. Diploma thesis, Poltekkes Kemenkes Tanjungkarang.

SYAPITRI, CHOLLILA ERSANTI (2023) GAMBARAN PERILAKU HIDUP BERSIH DAN SEHAT (PHBS) RUMAH TANGGA PADA PENDERITA DIARE DI WILAYAH KERJA PUSKESMAS RAWAT INAP WAY KANDIS KOTA BANDAR LAMPUNG TAHUN 2023. Diploma thesis, POLTEKKES KEMENKES TANJUNGKARANG.

SYEFIRA, ZANIA (2023) PENGARUH PENDIDIKAN KESEHATAN DENGAN MEDIA YOUTUBE TERHADAP PENGETAHUAN KELUARGA TENTANG PERSIAPAN OPERASI RSUD Dr. H. ABDUL MOELOEK PROVINSI LAMPUNG TAHUN 2022. Diploma thesis, Poltekkes KemenkesTanjungkarang.

SYIFA, AFWINA (2023) GAMBARAN ASUPAN ENERGI DAN PROTEIN, POLA ASUH, DAN RIWAYAT PENYAKIT INFEKSI DENGAN KEJADIAN STUNTING BALITA USIA 24-59 BULAN DI PEKON TANJUNG JATI WILAYAH KERJA PUSKESMAS PASAR SIMPANG. Diploma thesis, POLTEKKES KEMENKES TANJUNGKARANG.

Sari, Anggi Diah Putri Permata (2023) ASUHAN KEPERAWATAN GANGGUAN KEBUTUHAN NYAMAN (NYERI) PADA PASIEN COLIC ABDOMEN DI RUANG PENYAKIT DALAM RUMAH SAKIT TK IV 02.07.04 DENKESYAH 02.04.03 PROVINSI LAMPUNG TAHUN 2023. Diploma thesis, Poltekkes KemenkesTanjungkarang.

Sari, Annisa Marrizka (2023) ASUHAN KEPERAWATAN GERONTIK DENGAN GANGGUAN RASA NYAMAN TERHADAP TN. M PADA KASUS GOUT ARTHRITIS DI DESA MULANG MAYA KEC. KOTABUMI SELATAN KAB. LAMPUNG UTARA TANGGAL 25 – 27 OKTOBER 2022. Diploma thesis, Poltekkes Kemenkes Tanjungkarang.

Sari, Eva Nopita (2023) PEMBUATAN GIGI TIRUAN SEBAGIAN LEPASAN AKRILIK RAHANG BAWAH KLASIFIKASI KENNEDY KELAS II MODIFIKASI 1 DENGAN KASUS MIGRASI DAN EKSTRUSI GIGI. Diploma thesis, Poltekkes KemenkesTanjungkarang.

Sari, Yetty Prisca (2023) PEMBUATAN GIGI TIRUAN SEBAGIAN LEPASAN AKRILIK PADA GIGI 11, 21, DAN 22 DENGAN KASUS CROWDING RAHANG BAWAH ( LAPORAN KASUS ). Diploma thesis, Poltekkes KemenkesTanjungkarang.

Sudoto, Vita Apriliani (2023) PEMBUATAN GIGI TIRUAN SEBAGIAN LEPASAN AKRILIK RAHANG ATAS DAN RAHANG BAWAH KLASIFIKASI KENNEDY KELAS III MODIFIKASI 1 DENGAN KASUS EDENTULOUS AREA YANG SEMPIT. Diploma thesis, Poltekkes KemenkesTanjungkarang.

T

TAJUDDIN, ALISYA GITA PUTRI (2023) PERBANDINGAN ANTARA SKALA KEPOSITIFAN TUBEX DENGAN JUMLAH LEUKOSIT, LIMFOSIT, NEUTROFIL PADAPASIEN DEMAM TIFOID di RS PERTAMINA BINTANG AMIN. Diploma thesis, Poltekkes Kemenkes Tanjungkarang.

TALIYA, MUTIARA ARI (2023) PERSYARATAN KESEHATAN RUMAH TINGGAL YANG BERHUBUNGAN DENGAN KEJADIAN TUBERKULOSIS PARU DI WILAYAH KERJA UPTD PUSKESMAS KOTABUMI II KECAMATAN KOTABUMI SELATAN TAHUN 2023. Diploma thesis, Poltekkes Kemenkes Tanjung Karang.

TAMA, RIZKA LIA SINDY (2023) ASUHAN KEBIDANAN NIFAS DENGAN PUTING SUSU LECET DI TEMPAT PRAKTIK MANDIRI BIDAN KARTINI TULANG BAWANG BARAT. Diploma thesis, Poltekkes Tanjungkarang.

TAMARA, DETI (2023) TINGKAT KEBERHASILAN PENYULUHAN METODE CERAMAH DAN VIDEO ANIMASI TERHADAP KEBERSIHAN GIGI DAN MULUT MURID KELAS 3 SDN 3 LANGKAPURA TAHUN 2023. Diploma thesis, Poltekkes Kemenkes Tanjungkarang.

TAMARA, RINDI YANTI (2023) ASUHAN KEPERAWATAN GANGGUAN KEBUTUHAN AKTIVITAS PADA PASIEN DENGAN SPACE OCCUPYING LESSION (SOL) DAN STROKE INFARK DI RUANG BOUGENVIL RSUD DR. H. ABDUL MOELOEK PROVINSI LAMPUNG TAHUN 2023. Diploma thesis, Poltekkes KemenkesTanjungkarang.

TANIA, SERLI ERA (2023) PERBEDAAN PENYEMBUHAN LUKA MENGGUNAKAN BALUTAN TRANSPARAN FILM DENGAN BALUTAN KONVENSIONAL PADA LUKA PASIEN POST SECTIO CAESAREA DI RSUD Dr. H. ABDUL MOELOEK PROVINSI LAMPUNG. Diploma thesis, Poltekkes KemenkesTanjungkarang.

TAUFIQURRAHMAN, BAGAS (2023) ASUHAN KEPERAWATAN GANGGUAN PEMENUHAN KEBUTUHAN AKTIVITAS DAN ISTIRAHAT PADA PASIEN ASAM URAT DI DESA SRIMULYO 1 PEMANGGILAN NATARLAMPUNG SELATAN TAHUN 2023. Diploma thesis, Poltekkes KemenkesTanjungkarang.

TAUPIQURRAHMAN, TAUPIQURRAHMAN (2023) GAMBARAN PENGETAHUAN MASYARAKAT DESA KEMBANG TANJUNG KABUPATEN LAMPUNG UTARA TENTANG JURUSAN TEKNIK GIGI POLITEKNIK KESEHATAN TANJUNGKARANG TAHUN 2023. Diploma thesis, POLTEKKES KEMENKES TANJUNGKARANG.

TIARA, TIARA (2023) ASUHAN KEBIDANAN BAYI BERAT LAHIR RENDAH UNTUK PENCEGAHAN STUNTING DI TEMPAT PRAKTIK BIDAN NURUL MARFUAH TULANG BAWANG BARAT. Diploma thesis, Poltekkes Tanjungkarang.

TIAS PRATAMA, IRVAN (2023) PERBEDAAN IKAN MAS KOI (CYPRINUS CARPIO)IKAN NILA (OREOCHROMIS NILOTICUS BLEEKER) DAN IKAN BETOK (ANABAS TESTUDINEUS) SEBAGAI PREDATOR JENTIK NYAMUK AEDES AEGYPTI. Diploma thesis, POLTEKKES KEMENKES TANJUNGKARANG.

TISAN, M. ILHAM (2023) HUBUNGAN AKTIVITAS KOLINESTERSASE TERHADAP PARAMETER ANEMIA PADA PETANI DI DESA MARGODADI KECAMATAN JATI AGUNG KABUPATEN LAMPUNG SELATAN. Diploma thesis, Poltekkes Kemenkes Tanjungkarang.

TOBING, NUR MARCHELINA HARDIANTY L (2023) Efekivitas Ekstrak Serbuk Biji Lada Hitam (Piper nigrum) Sebagai Insektisida Nabati Terhadap Kecoa Rumah (Periplaneta americana). Diploma thesis, Poltekkes Kemenkes Tanjung Karang.

TRIANISA, MULYA (2023) PENGARUH TERAPI BERMAIN COLORING CLAY TERHADAP PENURUNAN KECEMASAN HOSPITALISASI PADA ANAK PRA SEKOLAH DI RUANG RAWAT BEDAH ANAK RSUD DR. H. ABDUL MOELOEK TAHUN 2023. Diploma thesis, Poltekkes KemenkesTanjungkarang.

TRIYONO, OLVA NUGRAHEMI (2023) HUBUNGAN DUKUNGAN SOSIAL TERHADAP TERJADINYA POST PARTUM BLUES PADA PASIEN POST OPERASI SECTIO CAESAREA DI RSIA ANUGERAH MEDICAL CENTER KOTA METRO TAHUN 2023. Diploma thesis, Poltekkes KemenkesTanjungkarang.

Tama, Helen Marta Boy (2023) RANCANG BANGUN ALAT PEMILAH SAMPAH PLASTIK BERBASIS SENSORIK RGB (RED, GREEN, BLUE) SEBAGAI LANGKAH PENGEMBANGAN TEKNOLOGI PADA PROSES PEMILAHAN SAMPAH PLASTIK. Diploma thesis, Poltekkes Kemenkes Tanjung Karang.

Tanjungkarang, Poltekkes Kemenkes (2023) Pidato Pengukuhan Sidang Senat Wisuda 2023. Diploma thesis, Poltekkes Kemenkes Tanjungkarang.

Tarigan, Desri Rosa BR (2023) HUBUNGAN POLA MAKAN, AKTIVITAS FISIK DAN KONDISI STRES DENGAN KADAR GULA DARAH PADA PENDERITA DIABETES MELITUS TIPE 2. Diploma thesis, POLTEKKES KEMENKES TANJUNGKARANG.

Trigunarso, Sri Indra and Febrihartati, Isura (2023) Influence of organizational behavior and SIMRS on ER employees performance in dr.H.Abdul Moeloek hospital Lampung. Diploma thesis, Poltekkes Tanjungkarang.

U

UBAYDILLAH, IQBAL (2023) PERBANDINGAN JUMLAH TROMBOSIT DAN INDEKS TROMBOSIT BERDASARKAN JENIS INFEKSI PADA PASIEN DEMAM BERDARAH DENGUE (DBD) DI RSUD Dr. H. ABDUL MOELOEK PROVINSI LAMPUNG. Diploma thesis, Poltekkes KemenkesTanjungkarang.

ULFA, AMALYN MULYA (2023) KORELASI D-DIMER, PT, APTT TERHADAP DERAJAT KEPARAHAN PADA PASIEN COVID-19 DI RSUD dr. H. ABDUL MOELOEK PROVINSI LAMPUNG TAHUN 2021. Diploma thesis, Poltekkes KemenkesTanjungkarang.

UMAIROH, UMAIROH (2023) ASUHAN KEPERAWATAN GANGGUAN RASA NYAMAN PADA KASUS DISPEPSIA TERHADAP NY.N DI RUANG PENYAKIT DALAM RSD MAYJEND HM RYACUDU KOTABUMI LAMPUNG UTARA TANGGAL 7 – 9 NOVEMBER 2022. Diploma thesis, Poltekkes Kemenkes Tanjungkarang.

UMAYYAH, SITI (2023) PENGARUH KOMBINASI TEKHNIK DISTRAKSI AUDIOVISUAL DAN AROMATERAPI LAVENDER TERHADAP PENURUNAN NYERI PASIEN PASCA BEDAH DENGAN GENERAL ANESTESI DI RSUD DR. H. ABDUL MOELOEK PROVINSI LAMPUNG TAHUN 2023. Diploma thesis, Poltekkes KemenkesTanjungkarang.

UMAYYAH, SITI (2023) PENGARUH KOMBINASI TEKHNIK DISTRAKSI AUDIOVISUAL DAN AROMATERAPI LAVENDER TERHADAP PENURUNAN NYERI PASIEN PASCA BEDAH DENGAN GENERAL ANESTESI DI RSUD DR. H. ABDUL MOELOEK PROVINSI LAMPUNG TAHUN 2023. Diploma thesis, Poltekkes KemenkesTanjungkarang.

UMMAMY, ALVIRA RIZA (2023) GAMBARAN PENDERITA MALARIA DI WILAYAH KERJA PUSKESMAS PADANG CERMIN KABUPATEN PESAWARAN TAHUN 2022. Diploma thesis, Poltekkes KemenkesTanjungkarang.

UTAMA, DEDEN KURNIA (2023) ANALISIS WAKTU TUNGGU PELAYANAN RESEP OBAT DI INSTALASI FARMASI RAWAT JALAN RUMAH SAKIT PERTAMINA BINTANG AMIN TAHUN 2023. Diploma thesis, Poltekkes KemenkesTanjungkarang.

UTAMA, DEDEN KURNIA (2023) LAPORANTUGAS AKHIR KEMENTERIAN KESEHATAN REPUBLIK INDONESIA POLITEKNIK KESEHATAN TANJUNGKARANG JURUSAN FARMASI TAHUN 2023. Diploma thesis, Poltekkes KemenkesTanjungkarang.

UTAMI, ANNISA DIAN (2023) FAKTOR - FAKTOR YANG BERHUBUNGAN DENGANKEJADIAN HIPOTERMI PADA PASIEN POST OPERASI DENGAN GENERAL ANESTESI DI INSTALASI BEDAHSENTRAL RSUD Dr. H. ABDUL MOELOEK PROVINSI LAMPUNG TAHUN 2023. Diploma thesis, Poltekkes Kemenkes Tanjungkarang.

UTAMI, INDAH (2023) GAMBARAN KEBERHASILAN PENYULUHAN TEKNIK TELL SHOW DO TERHADAP PENGETAHUAN MEMELIHARA KESEHATAN GIGI SISWA/I SD TUNAGRAHITA DI SLBN TANGGAMUS DALAM UPAYA PENURUNAN OHI-S TAHUN 2023. Diploma thesis, Poltekkes Kemenkes Tanjungkarang.

UTAMI, SHINTIA LEGA (2023) HUBUNGAN BODY IMAGE DAN SELF ESTEEM DENGAN QUALITY OF LIFE PADA PASIEN POST OPERASI MASTEKTOMI DI RSUD DR. H. ABDUL MOELOEK PROVINSI LAMPUNG TAHUN 2023. Diploma thesis, Poltekkes Kemenkes Tanjungkarang.

UTAMI, VINA RESTI (2023) GAMBARAN PROFIL HEMATOLOGI PADA PASIEN GGK PRA HEMODIALISIS DI RSUD Dr. H. ABDUL MOELOEK PROVINSI LAMPUNG TAHUN 2022. Diploma thesis, Poltekkes KemenkesTanjungkarang.

UTAMI, YUKE YURISTYA (2023) GAMBARAN VARIASI MENU, SISA MAKANAN, DAN ASUPAN ZAT GIZI MAKRO DI PONDOK PESANTREN AL-MUJTAMA’ AL ISLAMI LAMPUNG SELATAN TAHUN 2023. Diploma thesis, POLTEKKES KEMENKES TANJUNGKARANG.

UTARI, FENI VALENCIANA (2023) GAMBARAN MIKROSKOPIS PENDERITA MALARIA PADA ANAK USIA 5-14 TAHUN BERDASARKAN STADIUM KLINIS DI WILAYAH KERJA PUSKESMAS HANURA TELUK PANDAN KABUPATEN PESAWARAN TAHUN 2022. Diploma thesis, Poltekkes KemenkesTanjungkarang.

UTARI, NADILA (2023) ASUHAN KEBIDANAN BALITA DENGAN KETERLAMBATAN PERKEMBANGAN ASPEK MOTORIK HALUS DI TPMB UMAROH DESA MARGA JAYA INDAH KECAMATAN PAGAR DEWA TULANG BAWANG BARAT. Diploma thesis, Poltekkes Tanjungkarang.

Umami, Nurrahmi and Farahdiba, Idha and Argaheni, Niken Bayu and Anggarini, Yetti (2023) Pelayanan Holistik Dalam Kebidanan. PT Global Eksekutif teknologi, Padang.

V

VALENSIA, RIKZA (2023) GAMBARAN KONDISI RUMAH BALITA PENDERITA PNEUMONIA DI WILAYAH KERJA RAJABASA INDAH BANDAR LAMPUNG TAHUN 2022. Diploma thesis, Poltekkes Tanjungkarang.

VALENTINE, TARISA (2023) PENERAPAN TEKNIK RELAKSASI OTOT PROGRESIF PADAPASIEN NEFROLITIASIS POST OPNEFROLITOTOMI DENGANMASALAHKEPERAWATANNYERIDI RUMAH SAKITMARDIWALUYOMETRO TAHUN2023. Diploma thesis, Poltekkes Kemenkes Tanjungkarang.

VALESKA, FIDELA (2023) HUBUNGAN FAKTOR LINGKUNGAN FISIK RUMAH DAN PENGETAHUAN MASYARAKAT TERHADAP PREVALENSI TUBERKULOSIS PARU DI WILAYAH KERJA PUSKESMAS RAWAT INAP SUKAMAJU KOTA BANDAR LAMPUNG TAHUN 2023. Diploma thesis, Poltekkes Kemenkes Tanjung Karang.

VANIA, NI WAYAN LISA (2023) HUBUNGAN KONDISI LINGKUNGAN FISIK RUMAH DAN PERILAKU MASYARAKAT DENGAN KEJADIAN TUBERKULOSIS PARU DI WILAYAH KERJA PUSKESMAS RAWAT INAP KEDATON KOTA BANDAR LAMPUNG TAHUN 2023. Diploma thesis, Poltekkes Kemenkes Tanjung Karang.

VANIAR, LOVI (2023) ASUHAN KEPERAWATAN NYERI AKUT PADA PASIEN POST OP MASTEKTOMI DENGAN INTERVENSI TARIK NAFAS DALAM KOMBINASI GENGGAM JARI DI RUANG BEDAH MAWAR RUMAH SAKIT ABDUL MOELOEK PROVINSI LAMPUNG TAHUN 2023. Diploma thesis, Poltekkes Kemenkes Tanjungkarang.

VERONICA, ALMA (2023) IMPLEMENTASI EDUKASI PERAWATAN LUKA PADA PASIEN DENGAN HIPERGLIKEMIA POST OPERASI AMPUTASI DI RS MARDI WALUYO METRO. Diploma thesis, Poltekkes Kemenkes Tanjungkarang.

W

WAHYUDI, FAJAR DESMA (2023) ANALISIS SURVIVAL PENDERITA COVID-19 DI PROPINSI LAMPUNG TAHUN 2021. Masters thesis, Poltekkes Kemenkes Tanjungkarang.

WAHYUNI, DELVIA RIZKA (2023) PEMBERIAN SAYUR DAUN LEMBAYUNG DALAM PENINGKATAN PRODUKSI ASI IBU MENYUSUI PADA NY. P DI PMB DWI LESTARI, A.Md.Keb LAMPUNG SELATAN. Diploma thesis, Poltekkes Kemenkes Tanjungkarang.

WAHYUNI, MEISA (2023) PERBANDINGAN JUMLAH TROMBOSIT PASIEN LEUKEMIA SEBELUM DAN SESUDAH TRANSFUSI TROMBOSIT KONSENTRAT (TC) DI RSUD Dr. H. ABDUL MOELOEK TAHUN 2021-2022. Diploma thesis, Poltekkes KemenkesTanjungkarang.

WAHYUNI, PUTRI (2023) GAMBARAN PENGGUNA GIGI TIRUAN LEPASAN AKRILIK DI RUMAH SAKIT UMUM DAERAH Dr. H. ABDUL MOELOEK PROVINSI LAMPUNG. Diploma thesis, Poltekkes KemenkesTanjungkarang.

WAHYUNI, SRI (2023) ASUHAN KEPERAWATAN GANGGUAN KEBUTUHAN RASA NYAMAN (NYERI AKUT) PADA PASIEN POST OPERASI FRAKTUR TIBIA FIBULA SINISTRA DAN FRAKTUR TIBIA DEXTRA DI RUANG BEDAH RUMAH SAKIT DR. A. DADI. TJOKRODIPO BANDAR LAMPUNG TAHUN 2023. Diploma thesis, Poltekkes KemenkesTanjungkarang.

WANDIRA, AYU (2023) FAKTOR-FAKTOR YANG BERHUBUNGAN DENGAN KECEMASAN PASIEN PRE OPERASIDI RUMAH SAKIT UMUM HANDAYANIKOTABUMILAMPUNG UTARATAHUN 2023. Diploma thesis, Poltekkes Kemenkes Tanjungkarang.

WANDIRA, ESTI (2023) ASUHAN KEPERAWATAN GANGGUAN PEMENUHAN KEBUTUHAN RASA NYAMAN PADA PASIEN HIPERTENSI DESA SRIMULYO 1 RT 3 PEMANGGILAN KECAMATANNATAR KABUPATEN LAMPUNG SELATAN. Diploma thesis, Poltekkes KemenkesTanjungkarang.

WANVILLYOV, SHAGGY NATASHA (2023) ASUHAN KEPERAWATAN KELUARGA DENGAN GANGGUAN KEBUTUHAN NUTRISI PADA KASUS DIABETES MELLITUS TERHADAP Tn. E DI KELURAHAN KOTA ALAM WILAYAH KERJA PUSKESMAS KOTABUMI II TANGGAL 29-31 MARET 2023. Diploma thesis, Poltekkes Kemenkes Tanjungkarang.

WARDAH INAYAH, ASNUR (2023) PENERAPAN ENDORPHIN MASSAGE PADA IBU BERSALIN KALA I (NY.N) DI PMB SITI HAJAR, S.ST. Diploma thesis, Poltekkes Kemenkes Tanjungkarang.

WARDHANA, MADE KRISNA (2023) ASUHAN KEPERAWATAN GAWAT DARURAT DENGAN GANGGUAN KEBUTUHAN OKSIGENASI PADA KASUS STROKE HEMORAGIK TERHADAP NY. E DI IGD RSU HANDAYANI KOTABUMI LAMPUNG UTARA TANGGAL 25 NOVEMBER 2022. Diploma thesis, Poltekkes Kemenkes Tanjungkarang.

WATI, AGUSTINA PRABA (2023) ASUHAN KEPERAWATAN PASIEN DENGAN GANGGUAN KEBUTUHAN ISTIRAHAT DAN TIDUR PADA KASUSPOST SECTIO CAESAREA TERHADAP Ny.S DI RUANG KEBIDANAN RSU HANDAYANI KOTABUMI LAMPUNG UTARA TANGGAL 29-31 MARET 2023. Diploma thesis, Poltekkes Kemenkes Tanjungkarang.

WELLA, FEVI JUNITA (2023) GAMBARAN PENYIMPANAN OBAT DI GUDANG FARMASI DINAS KESEHATAN KABUPATEN PESISIR BARAT TAHUN 2023. Diploma thesis, Poltekkes KemenkesTanjungkarang.

WI, RIANTHY PUSPARINI PUTRI. (2023) GAMBARANPERENCANAANMENUDANPENGADAAN BAHANMAKANANSERTACITARASAMAKANAN DI LAPASKELASIIAKOTABUMI LAMPUNGUTARA TAHUN2023. Diploma thesis, POLTEKKES KEMENKES TANJUNGKARANG.

WIBOWO, GILANG PRADIPTA (2023) GAMBARAN ASUPAN LEMAK, SERAT DAN KOLESTEROL PADA PENDERITA PENYAKIT JANTUNG KORONER DI POLI KLINIK RAWAT JALAN RSUD JENDRAL AHMAD YANI METRO TAHUN 2023. Diploma thesis, Poltekkes Kemenkes Tanjungkarang.

WICAKSANA, GARIEL FARHAN (2023) HUBUNGAN DUKUNGAN KELUARGA DENGAN TINGKAT KECEMASAN PASIEN PRE SPINAL ANESTESI DI RSUD Dr. H. ABDUL MOELOEK PROVINSI LAMPUNG TAHUN 2022. Diploma thesis, Poltekkes Kemenkes Tanjungkarang.

WIDIAWATI, WIDIAWATI (2023) PENERAPAN PEMBERIAN PERMEN JAHE UNTUK MENGURANGI EMESIS GRAVIDARUM PADA IBU HAMIL TRIMESTER I DI PMB TRINI S.Tr.Keb.,SKM. Diploma thesis, Poltekkes Kemenkes Tanjungkarang.

WIDYATAMA, DINDA FEBILIA WIDYATAMA (2023) PELAKSANAAN PENERAPAN SISTEM MANAJEMEN KESELAMATAN DAN KESEHATAN KERJA RUMAH SAKIT (SMK3 RS) DI RUMAH SAKIT ISLAM METRO TAHUN 2023. Diploma thesis, Poltekkes Kemenkes Tanjung Karang.

WIJAYA, VERA (2023) PENATALAKSANAAN ASUHAN GIZI TERSTANDAR PADA PASIEN DIABETES MELITUS TIPE 2 DI RUANG RAWAT INAP PENYAKIT DALAM B RSUD JENDRAL AHMAD YANI KOTA METRO TAHUN 2023. Diploma thesis, Poltekkes KemenkesTanjungkarang.

WIJAYA, VERA (2023) PENATALAKSANAAN ASUHAN GIZI TERSTANDAR PADA PASIEN DIABETES MELITUS TIPE 2 DI RUANG RAWAT INAP PENYAKIT DALAM B RSUD JENDRAL AHMAD YANI KOTA METRO TAHUN 2023. Diploma thesis, Poltekkes KemenkesTanjungkarang.

WINDIYASTI, SHINTA (2023) IMPLEMENTASIPERAWATAN LUKA MODERN DRESSING (TRANSPARENT FILM)PADAPASIEN GANGGUAN INTEGRITAS JARINGANPOST OPERATIF APENDIKTOMIDI RSUD DR. H. ABDUL MOELOEK PROVINSI LAMPUNG TAHUN 2023. Diploma thesis, Poltekkes Kemenkes Tanjungkarang.

WINDIYASTI, SHINTA (2023) PENGARUH HEALTH EDUCATION MEDIA YOUTUBE TERHADAP SIKAP MOBILISASI DINI PADA PASIEN POST OPERASI LAPARATOMI DI RSUD DR. H ABDUL MOELOEK PROVINSI LAMPUNG TAHUN 2022. Diploma thesis, Poltekkes KemenkesTanjungkarang.

WISAKIH, NYOMAN RAMITA (2023) PERBEDAAN KADAR ASAM URAT SEBELUM DAN SESUDAH MENGKONSUMSI JUS SIRSAK. Diploma thesis, Poltekkes Kemenkes Tanjungkarang.

WULANDARI, DINDA (2023) ASUHAN KEBIDANAN PADA IBU HAMIL DENGAN HIPEREMESIS GRAVIDARUM DI TEMPAT PRAKTIK MANDIRI BIDAN SEPTIYANINGSIH, S.TR.KEB KARYA MAKMUR LAMPUNG TIMUR. Diploma thesis, Poltekkes Tanjungkarang.

WULANDARI, I LUH EKA (2023) GAMBARAN KEBISINGAN DI LABORATORIUM TEKNIK GIGI POLITEKNIK KESEHATAN TANJUNGKARANG. Diploma thesis, Poltekkes Kemenkes Tanjungkarang.

WULANDARI, INTAN (2023) ASUHAN KEBIDANAN PADA BALITA DENGAN PERKEMBANGAN MERAGUKAN DI TPMB TRIANA ANJARINI WAY JEPARA LAMPUNG TIMUR. Diploma thesis, Poltekkes Tanjungkarang.

WULANDARI, KRISTANTI (2023) PENGARUH TERAPI ZIKIR ASMA’UL HUSNA TERHADAP PENURUNAN INTENSITAS NYERI PASIEN POST OPERASI SECTIO CAESAREA DI RSIA ANUGERAH MEDICAL CENTRE KOTA METRO TAHUN 2023. Diploma thesis, Poltekkes KemenkesTanjungkarang.

WULANDARI, RENI (2023) ASUHAN KEBIDANAN KEHAMILAN DENGAN ANEMIA RINGAN DI PRAKTIK MANDIRI BIDAN DONA MARISA TULANG BAWANG BARAT. Diploma thesis, Poltekkes Tanjungkarang.

WULANITA, YERA (2023) GAMBARAN DAMPAK ISU OBAT SIRUP PENYEBAB GAGAL GINJAL AKUT PADA ANAK TERHADAP PELAYANAN KEFARMASIAN DI APOTEK SINAR ANTASARI KOTA BANDAR LAMPUNG. Diploma thesis, Poltekkes KemenkesTanjungkarang.

Wiandhini, Annisa Putri (2023) PEMBUATAN ALAT ORTHODONTI LEPASAN AKTIF PADA KASUS CROWDING ANTERIOR RAHANG ATAS. Diploma thesis, Poltekkes KemenkesTanjungkarang.

Wulandari, Ririn (2023) GAMBARAN PENGETAHUAN MAHASISWA POLITEKNIK KESEHATAN TANJUNGKARANG TENTANG FUNGSI GIGI TIRUAN TAHUN 2023. Diploma thesis, Poltekkes KemenkesTanjungkarang.

Y

YANA, FENI SEFTI (2023) PERBANDINGAN TINGKAT KEPUASAN PASIEN BPJS DAN NON BPJS TERHADAP PELAYANAN BPG DI PUSKESMAS KEBUN TEBU LAMPUNG BARAT TAHUN 2023. Diploma thesis, Poltekkes Kemenkes Tanjungkarang.

YANTI, HERMA (2023) HUBUNGAN DUKUNGAN KELUARGA DENGAN KONSEP DIRI PASIEN MASTEKTOMI DI RUANG KEMOTERAPI RSUD JENDRAL AHMAD YANI METRO PROVINSI LAMPUNG TAHUN 2023. Diploma thesis, Poltekkes KemenkesTanjungkarang.

YANTI, HERMA (2023) HUBUNGAN DUKUNGAN KELUARGA DENGAN KONSEP DIRI PASIEN MASTEKTOMI DI RUANG KEMOTERAPI RSUD JENDRAL AHMAD YANI METRO PROVINSI LAMPUNG TAHUN 2023. Diploma thesis, Poltekkes KemenkesTanjungkarang.

YANTI, NANDA NOPI (2023) ASUHAN KEPERAWATAN PASIEN DENGAN GANGGUAN TERMOREGULASI PADA KASUS FEBRIS TERHADAP An. N DIRUANG EDELWIS RSU HANDAYANI KOTABUMI TANGGAL 13-15 MARET 2023. Diploma thesis, Poltekkes Kemenkes Tanjungkarang.

YANTI, PUTRI REISA (2023) GAMBARAN PENGETAHUAN TENTANG GIZI, KADAR HB, ASUPAN Fe, PELANCAR DAN PENGHAMBAT PADA IBU HAMIL DI KELAS IBU HAMIL DESA TANJUNG SARI KECAMATAN NATAR LAMPUNG SELATAN TAHUN 2023. Diploma thesis, Poltekkes KemenkesTanjungkarang.

YANTIKA, DESNA (2023) ASUHAN KEBIDANAN PADA KEHAMILAN DENGAN EMESIS GRAVIDARUM DI PMB PONIRAH DI MARGOREJO, METRO. Diploma thesis, Poltekkes Tanjungkarang.

YANTO, RISKI ROBI (2023) ASUHAN KEPERAWATAN PASIEN DENGAN GANGGUAN TERMOREGULASI PADA KASUS KEJANG DEMAM TERHADAP An.N DI RUANG EDELWEIS RS HANDAYANI KOTABUMI 15-17 MARET 2023. Diploma thesis, Poltekkes Kemenkes Tanjungkarang.

YESPENI, RESPI (2023) GAMBARAN TINGKAT PENGETAHUAN, SIKAP DAN PERILAKU KELUARGA SADAR GIZI PADA IBU BALITA DESA TIMBUL PAYUNG KABUPATEN TANGGAMUS. Diploma thesis, POLTEKES KEMENKES TANJUNGKARANG.

YOLANDA, KHARISMA (2023) PENATALAKSANAAN ASUHAN GIZI TERSTANDARPADA PASIENDM TIPE IIDI RSUD ABDUL MOELOEK TAHUN 2023. Diploma thesis, POLTEKES KEMENKES TANJUNGKARANG.

YUDIKA, CHYNDO (2023) MANAJEMEN RISIKO LINGKUNGAN TERHADAP PENGELOLAAN SAMPAH DI PASAR PASIR GINTUNG KOTA BANDAR LAMPUNG TAHUN 2023. Diploma thesis, Poltekkes Kemenkes Tanjung Karang.

YULANDA, FETRISIA (2023) UJI EFEKTIVITAS EKSTRAK DAUN PANDAN WANGI (Pandanus amaryllifolius) DALAM MEMBUNUH LARVA NYAMUK Aedes aegypti INSTAR III. Diploma thesis, POLTEKKES KEMENKES TANJUNGKARANG.

YULENDA, CHINTIA (2023) PENGARUHPENGGUNAANOBATKUMURBERALKOHOLDANNON ALKOHOLTERHADAP PENURUNAN INDEKS PLAK DI PEKON KEGERINGANKECAMATANBATUBRAKKABUPATENLAMPUNG BARAT TAHUN 2023. Diploma thesis, Poltekkes Kemenkes Tanjungkarang.

YULI, WAYAN (2023) PENGARUH EDUKASI MENGGUNAKAN MEDIA BOOKLET DAN KOMUNIKASI TERAPEUTIK TERHADAP KECEMASAN PASIEN PRE OPERASI SECTIO CAESAREA DI RSUD DR. H. ABDUL MOELOEK PROVINSI LAMPUNG TAHUN 2023. Diploma thesis, Poltekkes KemenkesTanjungkarang.

YUNANDA, MELANIE (2023) ASUHAN KEBIDANAN PERKEMBANGAN MOTORIK HALUS DENGAN USIA 36 BULAN DI PMB SITI KHUZAIMAH. Diploma thesis, Poltekkes Tanjungkarang.

YUNIA PUTRI, ADELLIA (2023) GAMBARAN ASUPAN NATRIUM, KALIUM, LEMAK DAN AKTIVITAS FISIK PADA PENDERITA HIPERTENSI (Study Literature). Diploma thesis, POLTEKES KEMENKES TANJUNGKARANG.

YUNIAR, DAHLIA (2023) EFEKTIVITAS PEMBERIAN TEKNIK RELAKSASI GENGGAM JARI DAN SLOW STROKE BACK MASSAGE (SSBM) TERHADAP PERUBAHAN INTENSITAS NYERI PADA PASIEN POST OPERASI DI RUANG BEDAH RSUD DR. H. ABDUL MOELOEK PROVISI LAMPUNG TAHUN 2022. Diploma thesis, Poltekkes KemenkesTanjungkarang.

YUNINGSIH, ROMAILA EVI (2023) GAMBARAN STATUS ANEMIA DAN FAKTOR – FAKTOR YANG BERHUBUNGAN DENGAN ANEMIA PADA REMAJA PUTRI KELAS 8 DI SMPN 42 BANDAR LAMPUNG TAHUN 2023. Diploma thesis, Poltekkes Kemenkes Tanjungkarang.

YUNISA, RARA (2023) ASUHAN KEBIDANAN PADA KEHAMILAN DENGAN NYERI PUNGGUNG BAWAH DI TEMPAT PRAKTIK MANDIRI BIDAN D KECAMATAN PAGAR DEWA KABUPATEN TULANG BAWANG BARAT. Diploma thesis, Poltekkes Tanjungkarang.

YUNITA, CAHAYA OLVI (2023) FAKTOR-FAKTOR LINGKUNGAN YANG BERHUBUNGAN DENGAN KEJADIAN DIARE DI WILAYAH KERJA PUSKESMAS RAWAT INAP KEDATON KOTA BANDAR LAMPUNG TAHUN 2023. Diploma thesis, Poltekkes Kemenkes Tanjung Karang.

YUNITA, CORRY (2023) GAMBARAN PENGELOLAAN SAMPAH PASAR DI KECAMATAN KOTABUMI SELATAN LAMPUNG UTARA TAHUN 2023. Diploma thesis, POLTEKKES KEMENKES TANJUNGKARANG.

YUNIZA, SEPTI (2023) GAMBARAN KONSUMSI IKAN DAN STATUS GIZI PADA ANAK KELAS 5 - 6 DI SEKOLAH DASAR NEGERI 01 HAJIMENA KECAMATAN NATAR KABUPATEN LAMPUNG SELATAN TAHUN 2023. Diploma thesis, Poltekkes Kemenkes Tanjungkarang.

YURI, ELITA (2023) ASUHAN KEPERAWATAN DENGAN GANGGUAN KEBUTUHAN RASA NYAMAN PADA PASIEN HIPERTENSI DI DESA PEMANGGILAN KECAMATAN NATAR KABUPATEN LAMPUNG SELATAN TAHUN 2023. Diploma thesis, Poltekkes Kemenkes Tanjungkarang.

YURIKA, ECHA ASTI (2023) HUBUNGAN AKSES SANITASI DENGAN STUNTING PADA BALITA USIA 6-59 BULAN DI WILAYAH KERJA PUSKESMAS RAWAT INAP SEMULI RAYA KECAMATAN ABUNG SEMULI KABUPATEN LAMPUNG UTARA TAHUN 2023. Diploma thesis, Poltekkes Kemenkes Tanjung Karang.

YUSMUTIA, RANI PUTRI (2023) HUBUNGAN LINGKUNGAN FISIK DENGAN STRES KERJA PADA PEKERJA DI PTPN VII WAY BERULU KABUPATEN PESAWARAN TAHUN 2023. Diploma thesis, Poltekkes Tanjungkarang.

YUSNITA, NORA (2023) ASUHAN KEPERAWATAN PADA PASIEN POST OPERASI MASTEKTOMI DALAM MENGATASI NYERI AKUT DENGAN INTERVENSI TERAPI MUSIK KLASIK DI RSUDDr. Hi.ABDOEL MOLOEK PROVINSI LAMPUNG TAHUN 2023. Diploma thesis, Poltekkes Kemenkes Tanjungkarang.

YUSNITA, NORA (2023) HUBUNGAN HANDOVER DENGAN DOKUMENTASI KEPERAWATAN DI RUANG RAWAT BEDAH DI RUMAH SAKIT UMUM DAERAH ABDUL MOLOEK PROVINSI LAMPUNG TAHUN 2022. Diploma thesis, Poltekkes Kemenkes Tanjungkarang.

YUSTIANANDA, RINDA NISA (2023) HUBUNGAN STATUS GIZI DENGAN ERUPSI GIGI INSISIVUS RAHANG ATAS PADA ANAK USIA 7-8 TAHUN SDN 2 RAJABASA JAYA 2023. Diploma thesis, Poltekkes Kemenkes Tanjungkarang.

Yulistiana, Sri (2023) PEMBERIAN DAUN KELOR (MORINGA OLEIFERA) UNTUK MENINGKATKAN PODUKSI ASI PADA NY. L NIFAS DI PMB REDINSE SITORUS S.ST. Diploma thesis, Poltekkes Kemenkes Tanjungkarang.

Yupitasari, Winda (2023) GAMBARAN PENGETAHUAN, SIKAP DAN PRAKTIK PEMBERIAN MP-ASI PADA IBU BADUTA DI DESA TRIMULYO KABUPATEN PESAWARAN. Diploma thesis, POLTEKKES KEMENKES TANJUNGKARANG.

Z

ZAELANI, ADZANDA OKTAVEMA (2023) GAMBARAN PENDERITA MALARIA DI WILAYAH KERJA PUSKESMAS HANURA TELUK PANDAN KABUPATEN PESAWARAN TAHUN 2022. Diploma thesis, Poltekkes KemenkesTanjungkarang.

ZAELANI, ADZANDA OKTAVEMA (2023) GAMBARAN PENDERITA MALARIA DI WILAYAH KERJA PUSKESMAS HANURA TELUK PANDAN KABUPATEN PESAWARAN TAHUN 2022. Diploma thesis, Poltekkes KemenkesTanjungkarang.

ZAFIRAH, ANNISA SALMA (2023) PENGARUH SUHU DAN LAMA PENYIMPANAN TERHADAP JUMLAH ANGKA KAPANG PADA ROTI KEMASAN PRODUKSI RUMAHAN DI DESA GADINGREJO. Diploma thesis, Poltekkes Kemenkes Tanjungkarang.

ZAHRA, AINI (2023) POTENSI BIOLARVASIDA FRAKSI ETANOL KULIT PISANGKEPOK (Musaparadisiaca L.) TERHADAP LARVA INSTAR III NYAMUK Anopheles sp. DENGAN PERHITUNGAN LC50, LT50, dan GCMS. Diploma thesis, Poltekkes Kemenkes Tanjungkarang.

ZAHRA, NEHA SALSABILA (2023) GAMBARAN HASIL UJI CROSSMATCH PADA THALASEMIA MAYOR BERDASARKAN INTENSITAS TRANSFUSI DI UTD RUMAH SAKIT Dr. H. ABDUL MOELOEK. Diploma thesis, Poltekkes KemenkesTanjungkarang.

ZAHRANA, DIAJENG ANGGELIR (2023) GAMBARAN KONDISI FISIK RUMAH PENDERITA ISPA PADA BALITA DI WILAYAH KERJA PUSKESMAS WAY HALIM KOTA BANDAR LAMPUNG TAHUN 2023. Diploma thesis, POLTEKKES KEMENKES TANJUNGKARANG.

ZAKIA, ISMA (2023) GAMBARAN KONDISI RUMAH PENDERITA TUBERCULOSIS PARU DI KECAMATAN TANJUNGKARANG PUSAT TAHUN 2023. Diploma thesis, POLTEKKES KEMENKES TANJUNGKARANG.

ZAKIYYAH, UMI (2023) ASUHAN KEPERAWATAN PASIEN DENGAN GANGGUAN RASA NYAMAN : NYERI PADA KASUS POST OPERASI AMPUTASI ULKUS DIABETIKUM TERHADAP TN.S DI RUANG BEDAH RSUD JENDRAL AHMAD YANI METRO TANGGAL 07-09 NOVEMBER 2022. Diploma thesis, Poltekkes Kemenkes Tanjungkarang.

ZAKKY HATAMI, MUHAMMAD (2023) GAMBARAN KONSUMSI BUAH DAN SAYUR PADA ANAK SEKOLAH DASAR KELAS VI DI SDN BUMISARI NATAR LAMPUNG SELATAN TAHUN 2023. Diploma thesis, POLTEKKES KEMENKES TANJUNGKARANG.

ZEN, IMELDA TASYA (2023) GAMBARAN FAKTOR EKSTERNAL DAN DAYA TERIMA MAKANAN PADA PASIEN RAWAT INAP DI RSUD DEMANG SEPULAU RAYA LAMPUNG TENGAH TAHUN 2023. Diploma thesis, Poltekkes KemenkesTanjungkarang.

ZIDAN RAMADHAN, MUHAMMAD (2023) ANGKA KEPADATAN JENTIK NYAMUK AEDES AEGYPTI DI KELURAHAN BUMI WARAS WILAYAH KERJA PUSKESMAS RAWAT INAP SUKARAJA KOTA BANDAR LAMPUNG TAHUN 2023. Diploma thesis, POLTEKKES KEMENKES TANJUNGKARANG.

This list was generated on Sat Feb 24 22:43:45 2024 UTC.