Items where Subject is "RT Nursing"

Group by: Creators | Item Type
Jump to: A | B | C | D | E | F | G | H | I | J | K | L | M | N | O | P | Q | R | S | T | U | V | W | Y | Z
Number of items at this level: 1425.

A

ABIDAH, LAILA (2021) ASUHAN KEPERAWATAN GANGGUAN KERUSAKAN INTEGRITAS KULIT PADA KELUARGA BPK. K KHUSUSNYA NN. FS DENGAN DERMATITIS DI DESA SIMBAR WARINGIN KECAMATAN TRIMURJO LAMPUNG TENGAH TAHUN 2021. Diploma thesis, Poltekkes Tanjungkarang.

ABIDIN, ANNISA (2023) IMPLEMENTASI MOBILISASI DINI PADA PASIEN DENGAN NYERI AKUT POST OPERASI LAPARATOMI DI RUANG BEDAH RSUD DR. H. ABDUL MOELOEK PROVINSI LAMPUNG TAHUN 2023. Diploma thesis, Poltekkes Kemenkes Tanjungkarang.

ABIDIN, ANNISA (2022) PENGARUH TEKNIK RELAKSASI GENGGAM JARI TERHADAP KECEMASAN PASIEN PRE OPERASI PADA ANAK USIA SEKOLAH DI RSUDDR. H. ABDUL MOELOEK PROVINSI LAMPUNG TAHUN 2022. Diploma thesis, Poltekkes Tanjungkarang.

ACHMAD, AYU MUTIA (2020) ASUHAN KEPERAWATAN GANGGUAN KEBUTUHAN AKTIVITAS PADA PASIEN STROKE NON HEMORAGIK DI RUANG SYARAF RSUD JEND. AHMAD YANI METRO PROVINSI LAMPUNG TAHUN 2020. Diploma thesis, Poltekkes Tanjungkarang.

ADELIA, MERTI (2023) ASUHAN KEPERAWATAN GANGGUAN KEBUTUHAN RASA AMAN DAN NYAMAN NYERI PADA PASIEN PASCA TONSILEKTOMI DI RUANGAN MAWAR RS DENKESYAH LAMPUNG TAHUN 2023. Diploma thesis, Poltekkes KemenkesTanjungkarang.

ADELLIA, ADELLIA (2020) ASUHAN KEPERAWATAN GANGGUAN KEBUTUHAN OKSIGENASI PADA PASIEN PENYAKIT PARU OBSTRUKSI KRONIK (PPOK) DI RUANG PARU RSUD JENDRAL AHMAD YANI METRO TAHUN 2020. Diploma thesis, Poltekkes Tanjungkarang.

ADHA, IHSAN MUHAMMAD (2021) ASUHAN KEPERAWATAN GANGGUAN PEMENUHAN KEBUTUHAN AKTIVITAS PADA KELUARGA LANSIA KHUSUSNYA Tn. P DENGAN HIPERTENSI DI KEDAMAIAN KOTA BANDAR LAMPUNG TAHUN 2021. Diploma thesis, Poltekkes Tanjungkarang.

ADIANSYAH, ILHAM (2023) PENGARUH PSIKOEDUKASI TERHADAP RESPONS POST PARTUM BLUES PADA PASIEN POST OPERASI SEKSIO SESAREA DI RSIA ANUGERAH MEDIKAL CENTER KOTA METRO PROVINSI LAMPUNG TAHUN 2023. Diploma thesis, Poltekkes KemenkesTanjungkarang.

ADINDA, NASYWA (2023) ASUHAN KEPERAWATAN JIWA DENGAN GANGGUAN KEBUTUHAN PSIKOSOSIAL PADA PASIEN RESIKO PERILAKU KEKERASAN DI RUANG MELATI RUMAH SAKIT JIWA PROVINSI LAMPUNG TAHUN 2023. Diploma thesis, Poltekkes Kemenkes Tanjungkarang.

AFANDI, MUHAMMAD ERFAN (2022) ASUHANKEPERAWATANDENGANGANGGUANKEBUTUHAN RASANYAMANNYERIKRONISPADA PASIENHIPERTENSIDIRUMAHSAKITDKTBANDARLAMPUNG TAHUN2022. Diploma thesis, Poltekkes Tanjungkarang.

AFRIANSYAH, FANI (2020) ASUHAN KEPERAWATAN GANGGUAN PEMENUHAN KEBUTUHAN RASA NYAMAN(NYERI) PADA PASIEN POST OPERASI FRAKTUR HIDUNG DI RUANG BEDAH RSUD PRINGSEWUPROVINSI LAMPUNG TAHUN 2020. Diploma thesis, Poltekkes Tanjungkarang.

AFRIDALIA, ANISA (2023) ASUHAN KEPERAWATAN PASIEN DENGAN NYERI AKUTPADA KASUS POST SECTIO CAESAREA PARTUS PREMATURUS IMMINENS TERHADAP Ny. S DI RUANG KEBIDANAN RSU HANDAYANI KOTABUMI LAMPUNG UTARA TANGGAL 28-30 MARET 2023. Diploma thesis, Poltekkes Kemenkes Tanjungkarang.

AFRILIA, PUTRI MIRANDA (2020) ASUHAN KEPERAWATAN GANGGUAN KEBUTUHAN NUTRISI PADA PASIEN TIFOID DI RUANG ANYELIR RSUD DR. H. ABDUL MOELOEK PROVINSI LAMPUNG TAHUN 2020. Diploma thesis, Poltekkes Tanjungkarang.

AGRAINI, YESI (2022) ASUHAN KEPERAWATAN PERIOPERATIF PADA PASIEN TUMOR MAMMAE DENGAN TINDAKAN INSISIDI RUANG OPERASI RUMAH SAKIT BHAYANGKARA POLDA LAMPUNG TAHUN 2022. Diploma thesis, Poltekkes Tanjungkarang.

AGUNG, FICTOR YUSMAN (2022) ASUHAN KEPERAWATAN PERIOPERATIF PADA NY I DENGAN TINDAKAN SECTIO CAESARIA INDIKASI CEPHALOPELVIC DISPROPORTION (CPD) DI RUMAH SAKIT MARDI WALUYO METRO TAHUN 2022. Diploma thesis, Poltekkes Tanjungkarang.

AGUNG, FICTOR YUSMAN (2020) PENGARUH PEMBERIAN FOOT MASSAGE TERHADAP KUALITAS TIDUR KLIEN POST OPERASI DI RUANG BEDAH RSUD Dr. H. ABDUL MOELOEK PROVINSI LAMPUNG. Diploma thesis, Poltekkes Tanjungkarang.

AGUSTEEN, FADILAH (2023) ASUHAN KEPERAWATAN GANGGUAN KEBUTUHAN AMAN NYAMAN NYERI PADA PASIEN POST PARTUM SECTIO CAESAREA DI RUANG ANGGREK RS TK IV 02.07.04 DENKESYAH 02.04.03 KOTA BANDAR LAMPUNG TAHUN 2023. Diploma thesis, Poltekkes KemenkesTanjungkarang.

AGUSTIANA, ELSE FAVORITA (2022) ASUHAN KEPERAWATAN PERIOPERATIF PADA PASIEN KANKER REKTUM DENGAN TINDAKAN PEMBEDAHAN ABDOMINOPERINEAL RESECTION DI RS MARDI WALUYO METRO. Diploma thesis, Poltekkes Tanjungkarang.

AGUSTIN, DEVI RIZKI (2021) ASUHAN KEPERAWATAN PASIEN DENGAN GANGGUAN OKSIGENASI PADA KASUS STROKE NON HEMORAGIK TERHADAP TN. A DI RUANG FREESIA LANTAI 3 RSU HANDAYANI KOTABUMI LAMPUNG UTARA TANGGAL 8-10 MARET 2021. Diploma thesis, Poltekkes Tanjungkarang.

AGUSTIN, VIOLA TANTRI (2023) ASUHAN KEPERAWATAN JIWA GANGGUAN PEMENUHAN KEBUTUHAN PSIKOSOSIAL HALUSINASI PADA PASIEN SKIZOFRENIA DI RUANG NURI RUMAH SAKIT JIWA DAERAH PROVINSI LAMPUNG TAHUN 2023. Diploma thesis, Poltekkes KemenkesTanjungkarang.

AGUSTINA, ERNY (2020) ASUHAN KEPERAWATAN GANGGUAN KEBUTUHAN AKTIVITAS PADA PASIEN CONGESTIVE HEART FAILURE DI RSUD JENDRAL AHMAD YANI KOTA METRO TAHUN 2020. Diploma thesis, Poltekkes Tanjungkarang.

AGUSTINA, ERNY (2023) IMPLEMENTASI TERAPI RELAKSASI GENGGAM JARI PADA PASIEN DENGAN NYERI AKUT POST OPERASI HERNIOTOMI DI RS MARDI WALUYO METRO TAHUN 2023. Diploma thesis, Poltekkes Kemenkes Tanjungkarang.

AGUSTINA, ERNY (2023) PERBEDAAN PENGARUH TERAPI MUSIK KLASIK MOZART DAN INSTRUMENTAL KITARO KOI TERHADAP KUALITAS TIDUR PASIEN PRE OPERASI DI RSUD DR. H. ABDUL MOELOEK PROVINSI LAMPUNG TAHUN 2022. Diploma thesis, Poltekkes Kemenkes Tanjungkarang.

AGUSTINA, JOVANI (2022) ASUHAN KEPERAWATAN PERIOPERATIF PADA PASIEN NEVUS PIGMENTOSUS FACIALIS DENGAN TINDAKAN EKSISI DI RS BHAYANGKARA POLDA LAMPUNG TAHUN 2022. Diploma thesis, Poltekkes Tanjungkarang.

AGUSTINA, JOVANI (2022) ASUHAN KEPERAWATAN PERIOPERATIF PADA PASIEN NEVUS PIGMENTOSUS FACIALIS DENGAN TINDAKAN EKSISI DI RS BHAYANGKARA POLDA LAMPUNG TAHUN 2022. Diploma thesis, Poltekkes Tanjungkarang.

AGUSTINA, NESIA DWI (2021) ASUHAN KEPERAWATAN PERIOPERATIF PADA PASIEN APPENDIKSITIS DENGAN TINDAKAN APPENDIKTOMI DI RUANG OPERASI RUMAH SAKIT UMUM DAERAH Dr. H. BOB BAZAR, SKM KALIANDA TAHUN 2021. Diploma thesis, Poltekkes Tanjungkarang.

AGUSTINA, NESIA DWI (2020) PENGARUH TERAPI MUSIK INSTRUMENTAL TERHADAP KESIAPAN IBU MENYUSUI POST OPERASI SECTIO CAESAREA DI RSUD Dr. H. ABDUL MOELOEK PROVINSI LAMPUNG TAHUN 2020. Diploma thesis, Poltekkes Tanjungkarang.

AGUSTINA, SELA (2020) ASUHAN KEPERAWATAN DENGAN GANGGUAN KEBUTUHAN OKSIGENASI PADA KASUS ASMA BRONKIAL TERHADAP An. P DI RUANG ANAK RSD MAYJEND HM RYACUDU KABUPATEN LAMPUNG UTARA TANGGAL 08-10 APRIL 2019. Diploma thesis, Poltekkes Tanjungkarang.

AJIMANTARA, NICO ABILA (2021) ASUHAN KEPERAWATAN ANAK DENGANGANGGUAN TERMOREGULASI PADA KASUS DEMAM TYPHOID TERHADAPAN.A DIRUANG ANAK RSUD MAYJEND HM RYACUDUKOTABUMI LAMPUNG UTARA TANGGAL 08-09 MARET 2021. Diploma thesis, Poltekkes Tanjungkarang.

AKBAR, MUHAMMAD KHOIRI (2022) ASUHAN KEPERAWATAN JIWA DENGAN GANGGUAN SENSORI PERSEPSI HALUSINASI PENDENGARAN PADA KASUS SKIZOFRENIA TERHADAP Tn. A DI RUANG NURI RUMAH SAKIT JIWA DAERAH PROVINSI LAMPUNG TANGGAL 9 s.d 11 MARET 2021. Diploma thesis, Poltekkes Tanjungkarang.

ALAM, INDRA FAKSI (2021) ASUHAN KEPERAWATAN GANGGUAN MOBILITAS FISIK PADA KELUARGA BAPAK R KHUSUSNYA ANAK R DENGAN MASALAH KESEHATAN FRAKTUR FEMUR DI DESA PENUMANGAN KECAMATAN TULANG BAWANG TENGAH KABUPATEN TULANG BAWANG BARAT TAHUN 2021. Diploma thesis, Poltekkes Tanjungkarang.

ALAWIYAH, LUTFI (2021) ASUHAN KEPERAWATAN GANGGUAN PEMENUHAN KEBUTUHAN NUTRISI PADA TAHAP TUMBUH KEMBANG DEWASA KELUARGA BAPAK W DENGAN GASTRITIS DI DESA SUKOHARJO 2 KABUPATEN PRINGSEWU TAHUN 2021. Diploma thesis, Poltekkes Tanjungkarang.

ALDAYANTI, ALDAYANTI (2021) ASUHAN KEPERAWATAN PASIEN DENGAN GANGGUAN OKSIGENASI PADA KASUS ASMA BRONCHIAL TERHADAP Ny. Z DI RUANG PARU RSUD MAYJEND HM RYACUDU KOTABUMI LAMPUNG UTARATANGGAL 08-10 MARET 2021. Diploma thesis, Poltekkes Tanjungkarang.

ALFIANA, RISKA (2021) ASUHAN KEPERAWATAN DENGAN GANGGUAN OKSIGENASI PADA KASUS CIDERA KEPALA SEDANG TERHADAP TN.S DI RUANG INSTALASI GAWAT DARURAT RSUD JENDERAL AHMAD YANI KOTA METRO TANGGAL 29 MARET 2021. Diploma thesis, Poltekkes Tanjungkarang.

ALFIANA, RISQI (2021) ASUHAN KEPERAWATAN GANGGUAN KEBUTUHAN RASA NYAMAN NYERI PADA KELUARGA TN. W KHUSUSNYA AN. I DI DESA ENDANG REJO SEPUTIH AGUNG LAMPUNG TENGAH TAHUN 2021. Diploma thesis, Poltekkes Tanjungkarang.

ALFIANA, RISQI (2021) ASUHAN KEPERAWATAN GANGGUAN KEBUTUHAN RASA NYAMAN NYERI PADA KELUARGA TN. W KHUSUSNYA AN. I DI DESA ENDANG REJO SEPUTIH AGUNG LAMPUNG TENGAH TAHUN 2021. Diploma thesis, Poltekkes Tanjungkarang.

ALFIANINGRUM, LAILA RAMADHANI (2022) ASUHAN KEPERAWATAN GANGGUAN KEBUTUHAN OKSIGENASI PADA PASIEN PNEUMONIA DI RSUD Dr. A DADI TJOKRODIPO BANDAR LAMPUNG TAHUN 2022. Diploma thesis, Poltekkes Tanjungkarang.

ALFIATURROHMI, ALFIATURROHMI (2023) PENGARUH PIJAT REFLEKSI KAKI TERHADAP PENURUNAN INTENSITAS NYERI PADA IBU POST OPERASI SECTIO CAESAREA DI RSIA ANUGERAH MEDICAL CENTER KOTA METRO PROVINSI LAMPUNG TAHUN 2023. Diploma thesis, Poltekkes KemenkesTanjungkarang.

ALHAMMAMI, ALIFA (2023) PENGARUH PENGATURAN POSISI TIDUR PASIEN TERHADAP PERUBAHAN PERISTALTIK USUS PASIEN POST OPERASI DENGAN ANESTESI UMUM DI RUMAH SAKIT ABDUL MOELOEK PROVINSI LAMPUNG. Diploma thesis, Poltekkes KemenkesTanjungkarang.

ALHAMMAMI, ALIFA (2023) PENGARUH PENGATURAN POSISI TIDUR PASIEN TERHADAP PERUBAHAN PERISTALTIK USUS PASIEN POST OPERASI DENGAN ANESTESI UMUM DI RUMAH SAKIT ABDUL MOELOEK PROVINSI LAMPUNG. Diploma thesis, Poltekkes KemenkesTanjungkarang.

ALI, CHOIRUN NISA MUFTI (2021) ASUHAN KEPERAWATAN GANGGUAN KEBUTUHAN RASA NYAMAN (NYERI KRONIS) PADA LANSIA IBU F KELUARGA BAPAK H DENGAN GOUT ARTHRITIS DI DESA KOTA BESI KECAMATAN BATU BRAK LAMPUNG BARAT TAHUN 2021. Diploma thesis, Poltekkes Tanjungkarang.

ALI, HAIDIR (2022) ASUHAN KEPERAWATAN PERIOPERATIF PADA PASIEN ULKUS DIABETIKUM DENGAN TINDAKAN AMPUTASI DIGITI II PEDIS DEXTRA DI RSUD JENDRAL AHMAD YANI METRO TAHUN 2022. Diploma thesis, Poltekkes Tanjungkarang.

ALIANA, MADYA DESMA (2021) ASUHAN KEPERAWATAN PERIOPERATIF PADA PASIEN DENGAN OPERASI HERNIA INGUINALIS DENGAN TINDAKAN OPERASI HERNIOTOMI DI RUMAH SAKIT BHAYANGKARA BANDAR LAMPUNG TAHUN 2021. Diploma thesis, Poltekkes Tanjungkarang.

ALIE, SAHARA NOVI NUR (2021) ASUHAN KEPERAWATAN GANGGUAN KEBUTUHAN NUTRISI: KETIDAKSTABILAN KADAR GLUKOSA DARAH PADA KELUARGA TN. U DI HAJIMENA LAMPUNG SELATAN TAHUN 2021. Diploma thesis, Poltekkes Tanjungkarang.

ALMIRAYANI, ALMIRAYANI (2023) ASUHAN KEPERAWATAN NYERI AKUTDENGAN INTERVENSI KEPERAWATAN NECK STRECTHING EXERCISE PADA PASIEN POST OP SNNT DI RUMAH SAKIT BHAYANGKARA BANDAR LAMPUNG. Diploma thesis, Poltekkes Kemenkes Tanjungkarang.

ALTA, SHAFIRA SALSABILLA (2023) ASUHAN KEPERAWATAN GANGGUAN OKSIGENASI PADA KASUS TUBERKULOSIS PARU TERHADAP Tn.K DI RUANG FRESIA RSU HANDAYANI KOTABUMI LAMPUNG UTARA 11 - 13 NOVEMBER 2022. Diploma thesis, Poltekkes Kemenkes Tanjungkarang.

ALVIAN, MARTIN (2021) ASUHANKEPERAWATAN GANGGUAN PEMENUHAN KEBUTUHAN AKTIVITAS PADA KELUARGALANSIAKHUSUSNYAIBU Z DENGANHIPERTENSI DI KEMILINGKOTA BANDAR LAMPUNG TAHUN 2021. Diploma thesis, Poltekkes Tanjungkarang.

ALVIANITA, EKA (2020) ASUHAN KEPERAWATAN PERIOPERATIF PADA PASIEN APENDISITIS DENGAN TINDAKAN APENDIKTOMI DI RUANG OPERASI RUMAH SAKIT PERTAMINA BINTANG AMIN BANDAR LAMPUNG TAHUN 2020. Diploma thesis, Poltekkes Tanjungkarang.

ALVINA, RAHMA (2023) ASUHAN KEPERAWATAN DENGAN GANGGUAN KEBUTUHAN OKSIGENASI PADA KASUS POST KRANIOTOMI e.c STROKE HEMORAGIK TERHADAP Tn. T DI RUANG ICU RSUD JENDERAL AHMAD YANI METRO TANGGAL 14-15 OKTOBER 2022. Diploma thesis, Poltekkes Kemenkes Tanjungkarang.

ALYANAKA, ANTIRA (2021) ASUHAN KEPERAWATAN PASIEN DENGAN GANGGUAN KEBUTUHAN OKSIGENASI PADA KASUS STROKE HEMORAGIK TERHADAP Ny. R DI RUANG SARAF RSUD MAYJEND HM RYACUDU KOTABUMI LAMPUNG UTARA TANGGAL 08-10 MARET 2021. Diploma thesis, Poltekkes Tanjungkarang.

AMALIA, PUNGKY (2021) ASUHAN KEPERAWATAN PASIEN DENGAN GANGGUAN KEBUTUHAN KEAMANAN PADA KASUS POST SECTIO CAESAREA TERHADAP NY. S DI RUANG KEBIDANAN RSUD MAYJEND HM RYACUDU KOTABUMI LAMPUNG UTARA TANGGAL 08-10 MARET 2021. Diploma thesis, Poltekkes Tanjungkarang.

AMALIA, PUTRI (2023) ASUHAN KEPERAWATAN PASIEN DENGAN GANGGUAN KESEIMBANGAN CAIRAN PADA KASUS GLOMERULONEFIRITIS AKUT PASCA STREPTOKOKUS (GNAPS) TERHADAP AN.H DI RUANG EDELWEIS RSU HANDAYANI KOTABUMI LAMPUNG UTARA TANGGAL 14-16 MARET 2023. Diploma thesis, Poltekkes Kemenkes Tanjungkarang.

AMALINA, RIYANTI FADHILAH (2022) ASUHAN KEPERAWATAN PERIOPERATIVE PADA ANAK ILEUS OBSTRUKSI DENGAN TINDAKAN OPERASI LAPARATOMI DI RUMAH SAKIT MARDI WALUYO METRO PADA TAHUN 2022. Diploma thesis, Poltekkes Tanjungkarang.

AMALINA, RIYANTI FADHILAH (2021) PENGARUH DUKUNGAN KELUARGA DENGAN TEKNIK COMFORT KOLCABA TERHADAP TINGKAT NYERI PADA PASIEN PASCA OPERASI LAPARATOMI DI RSUD JEND. AHMAD YANI METRO PROVINSI LAMPUNG TAHUN 2021. Diploma thesis, Poltekkes Tanjungkarang.

AMANDA, REFIKA RISQI (2021) ASUHAN KEPERAWATAN DENGAN GANGGUAN KEBUTUHAN OKSIGENASI PADA KASUS ASMA BRONKIAL TERHADAP An.K DI RUANG ANAKRS HANDAYANI KOTABUMI LAMPUNG UTARA TANGGAL 08-10 MARET 2021. Diploma thesis, Poltekkes Tanjungkarang.

AMANDA, SALSABILA (2023) ASUHAN KEPERAWATAN GAWAT DARURAT DENGAN GANGGUAN OKSIGENASI PADA KASUS CEDERA KEPALA BERAT TERHADAP Tn.K DI RUANG IGD RSUD JENDRAL AHMAD YANI METRO TANGGAL 01 N0VEMBER 2022. Diploma thesis, Poltekkes Kemenkes Tanjungkarang.

AMAREL, AQILLA FADYA (2023) ASUHAN KEPERAWATAN TERHADAP NY. A DENGAN GANGGUAN MOBILITAS FISIK PADA KASUS POST SECTIO CAESAREA DI RUANG KEBIDANAN RSU HANDAYANI KOTABUMI, KABUPATEN LAMPUNG UTARA TANGGAL 27-29 MARET 2023. Diploma thesis, Poltekkes Kemenkes Tanjungkarang.

AMELIA, RIZKI (2022) ASUHAN KEPERAWATAN PERIOPERATIF PADA PASIEN SINUSITIS MAKSILARIS DENGAN TINDAKAN CALD WELL LUC DI RUMAH SAKIT MARDI WALUYO METRO TAHUN 2022. Diploma thesis, Poltekkes Tanjungkarang.

AMILIA, RISKA (2023) PERBEDAAN EFEKTIVITAS AROMATERAPI ROSE ESSENTAIL OIL DAN LAVENDER ESSENTAIL OIL TERHADAP KECEMASAN PASIEN PRE OPERASI DI RSUD H. ABDUL MOELOEK PROVINSI LAMPUNG TAHUN 2023. Diploma thesis, Poltekkes KemenkesTanjungkarang.

ANANDA, SANETI (2021) ASUHAN KEPERAWATAN PASIEN ANAK DENGAN GANGGUAN KEBUTUHAN OKSIGENASI PADA KASUSPNEUMONIA TERHADAP An.R DI RUMAH SAKIT HANDAYANI LANTAI II FRESIA KABUPATEN LAMPUNG UTARA TANGGAL 11-13 MARET 2021. Diploma thesis, Poltekkes Tanjungkarang.

ANDAMI, ALMA (2020) ASUHAN KEPERAWATAN GANGGUAN PEMENUHAN KEBUTUHAN NUTRISI PADA IBU HAMIL DENGAN HIPEREMESIS GRAVIDARUM DI PUSKESMAS KEDATON BANDAR LAMPUNG TAHUN 2020. Diploma thesis, Poltekkes Tanjungkarang.

ANDANI, TANDOK (2023) ASUHAN KEPERAWATAN GANGGUAN KEBUTUHAN NUTRISI PADA PASIEN HEPATITIS B DI RUMAH SAKIT BHAYANGKARA POLDA LAMPUNG TAHUN 2023. Diploma thesis, Poltekkes KemenkesTanjungkarang.

ANDARNANTI, CYNDI (2021) ASUHAN KEPERAWATAN KELUARGA GANGGUAN PEMENUHAN KEBUTUHAN RASA NYAMAN NYERI PADA KELUARGA TN. S KHUSUSNYA NY. P DENGAN DISPEPSIA DI KOTAGAJAH LAMPUNG TENGAH TAHUN 2021. Diploma thesis, Poltekkes Tanjungkarang.

ANDAYANI, RATNA (2020) ASUHAN KEPERAWATAN GANGGUAN PEMENUHAN KEBUTUHAN PSIKOSOSIAL RISIKO PERILAKU KEKERASAN PADA PASIEN SKIZOFRENIA DIRUMAH PENITIPAN KLIEN GANGGUAN JIWA AULIA RAHMA KOTA BANDAR LAMPUNG TAHUN 2020. Diploma thesis, Poltekkes Tanjungkarang.

ANDINI, FEBYLA PUTRI (2023) ASUHAN KEPERAWATAN KELUARGA DENGAN GANGGUAN AMAN DAN NYAMAN PADA KASUS FEBRIS TERHADAP AN.A DI DESA GUNUNG ANGGER WILAYAH KERJA PUSKESMAS KOTABUMI II TANGGAL 07 – 09 NOVEMBER 2022. Diploma thesis, Poltekkes Kemenkes Tanjungkarang.

ANDINI, FEMY (2023) ASUHAN KEPERAWATAN DENGAN GANGGUAN KEBUTUHAN AKTIVITAS PADA PASIEN HIPERTENSI DI WILAYAH KERJA PUSKESMAS HAJIMENA TAHUN 2023. Diploma thesis, Poltekkes KemenkesTanjungkarang.

ANDREANSYAH, DAVID (2021) ASUHAN KEPERAWATAN: GANGGUAN KEBUTUHAN RASA NYAMAN NYERI PADA IBU T KELUARGA BAPAK R DENGAN GOUT ARTHRITIS DI DESA PEMATANG PASIR KABUPATEN LAMPUNG SELATAN TAHUN 2021. Diploma thesis, Poltekkes Tanjungkarang.

ANDRIANI, CHICA (2020) ASUHAN KEPERAWATAN PERIOPERATIF PADA PASIEN DENGAN DIAGNOSA MEDIS KARSINOMA TIROID DENGAN TINDAKAN TIROIDEKTOMI TOTAL DI RUANG OPERASI RS DKT BANDAR LAMPUNG TAHUN 2020. Diploma thesis, Poltekkes Tanjungkarang.

ANDRIANI, SELVI (2021) ASUHAN KEPERAWATAN GANGGUAN KEBUTUHAN RASA NYAMAN NYERI PADA KELUARGA LANSIA BAPAK S KHUSUSNYA IBU M DENGAN HIPERTENSI DI DESA REBANG TINGGI KECAMATAN BANJIT KABUPATEN WAY KANAN TAHUN 2021. Diploma thesis, Poltekkes Tanjungkarang.

ANGELITA, DESPANI (2023) ASUHAN KEPERAWATAN GERONTIK DENGAN GANGGUAN KEBUTUHAN AMAN NYAMAN PADA KASUS GOUT ARTHRITIS TERHADAP NY. N DI DESA MULANG MAYA WILAYAH KERJA PUSKESMAS KOTABUMI II KABUPATEN LAMPUNG UTARA TANGGAL 24-27 OKTOBER 2022. Diploma thesis, Poltekkes Kemenkes Tanjungkarang.

ANGGARA, BENEDIKTUS REZA (2021) ASUHAN KEPERAWATAN PERIOPERATIF PADA PASIEN FRAKTUR FEMUR (TERTUTUP) DENGAN TINDAKAN OPEN REDUCTION INTERNAL FIXATION (ORIF) DI INSTALASI BEDAH SENTRAL RSUD. Dr. H. ABDUL MOELOEK PROVINSI LAMPUNG TAHUN 2021. Diploma thesis, Poltekkes Tanjungkarang.

ANGGARA, SABIQ RAFI ARHAB (2023) PENERAPAN TEKNIKGUIDED IMAGERY UNTUK MENGATASI MASALAH KEPERAWATAN NYERI AKUT PADA PASIEN ULKUS DIABETIKUM POST DEBRIDEMENT DI RS MARDI WALUYO KOTAMETRO TAHUN2023. Diploma thesis, Poltekkes Kemenkes Tanjungkarang.

ANGGARA, SABIQ RAFI ARHAB (2023) PENGARUH EDUKASI ROM AKTIF KOMBINASI MEDIA BOOKLET DAN DEMONSTRASI TERHADAP KEMAMPUAN MOBILISASI EKTREMITAS PADA PASIEN POST OPERASI FRAKTUR DI RSUD DR. HI. ABDUL MOELOEK TAHUN 2022. Diploma thesis, Poltekkes Kemenkes Tanjungkarang.

ANGGRAENI, AYU (2022) ASUHAN KEPERAWATAN GANGGUAN KEBUTUHAN NUTRISI PADA PASIEN DIABETES MELITUS DI RUANG PENYAKITDALAM RSUD DR. A. DADI TJOKRODIPO BANDAR LAMPUNG TAHUN 2022. Diploma thesis, Poltekkes Tanjungkarang.

ANGGRAENI, RISKA (2022) ASUHAN KEPERAWATAN PERIOPERATIF PENGAPURAN PLASENTA PADA IBU HAMIL DENGAN TINDAKAN SECTIO CAESAREA DI RUMAH SAKIT BHAYANGKARA POLDA LAMPUNG TAHUN 2022. Diploma thesis, Poltekkes Tanjungkarang.

ANGGRAENI, RISKA VERDIAN (2021) ASUHAN KEPERAWATAN PERIOPERATIF PADA PASIEN BENIGNA PROSTAT HIPERPLASIA DENGAN TINDAKAN TRANSURETHRAL RESECTION PROSTATE(TURP) DI RUANG OPERASI RUMAH SAKIT YUKUM MEDICAL CENTER TAHUN 2021. Diploma thesis, Poltekkes Tanjungkarang.

ANGGRAENI, RISKA VERDIAN (2020) PENGARUH PEMBERIAN AROMATERAPI INHALASI LEMON TERHADAP POST OPERATIVE NAUSEA VOMITUS (PONV) PADA PASIEN PASCA ANESTESI UMUM DI RUANG RAWAT INAP BEDAH RSUD Dr. H. ABDUL MOELOEK PROVINSI LAMPUNG TAHUN 2020. Diploma thesis, Poltekkes Tanjungkarang.

ANGGRAINI, INTAN (2023) ASUHAN KEPERAWATAN GANGGUAN KEBUTUHAN OKSIGEN PADA PASIEN PNEUMONIA DI RUANG ICU RSUD Dr. H. ABDUL MOELOEK PROVINSI LAMPUNG TAHUN 2023. Diploma thesis, Poltekkes KemenkesTanjungkarang.

ANGGRAINI, LUTHVIA HAMINDA (2022) ASUHAN KEPERAWATAN GANGGUAN KEBUTUHAN RASA AMAN NYAMAN PADA PASIEN POST APENDEKTOMI DI RUANG BEDAH UMUM RSUD JENDERAL AHMAD YANI METRO LAMPUNG TAHUN 2022. Diploma thesis, Poltekkes Tanjungkarang.

ANGGRAINI, RIKA (2021) ASUHAN KEPERAWATAN GANGGUAN PEMENUHAN KEBUTUHAN NYERI PADA ANAK USIA REMAJA KELUARGA BAPAK A DENGAN DYSMENORRHEA KHUSUNYA ANAK S DI DUSUN II KEBON BIBIT HAJIMENA NATAR LAMPUNG SELATAN TAHUN 2021. Diploma thesis, Poltekkes Tanjungkarang.

ANGGRAINI, SAFIRA (2020) ASUHAN KEPERAWATAN GANGGUAN KEBUTUHAN OKSIGENASI PADA PASIEN TUBERCULOSIS PARU DI RUANG PARU RSUD JEND. AHMAD YANI METRO TAHUN 2020. Diploma thesis, Poltekkes Tanjungkarang.

ANGGRAINI, VERONICA (2023) PENGARUH MURROTAL AL QUR’AN SURAH AR RAHMAN TERHADAP PENURUNAN INTENSITAS NYERI PADA PASIEN POST OPERASI LAPARATOMY DI RSUD JENDRAL AHMAD YANI DI KOTA METRO TAHUN 2023. Diploma thesis, Poltekkes KemenkesTanjungkarang.

ANGGREINI, NIMASWATI (2021) ASUHAN KEPERAWATAN PASIEN DENGAN GANGGGUAN RASA NYAMAN PADA KASUS POST OPERASI SECTIO CAESAREA DENGAN MALPOSISI JANIN LETAK (MELINTANG) TERHADAP NY. A DI RUANG KEBIDANAN RSU HANDAYANI KOTABUMI LAMPUNG UTARA, TANGGAL 8-10 MARET 2021. Diploma thesis, Poltekkes Tanjungkarang.

ANGGUN, NURUL ALIFIA (2020) ASUHAN KEPERAWATAN PERIOPERATIF PADA KASUS PERFORASI GASTER DENGAN TINDAKAN LAPAROTOMY DIRUANG OPERASI RSU MARDI WALUYO KOTA METRO. Diploma thesis, Poltekkes Tanjungkarang.

ANGKONANDO, ADI (2023) PENGARUH PEMBERIAN RELAKSASI GUIDED IMAGERY MUSIC TERHADAP TINGKAT KECEMASAN PASIEN PRE OPERASI SECTIO CAESAREA DI RSIA ANUGERAH MEDICAL CENTER KOTA METRO TAHUN 2023. Diploma thesis, Poltekkes KemenkesTanjungkarang.

ANI, EVI SHEPTY (2023) ASUHAN KEPERAWATAN GANGGUAN SIRKULASI PADA KASUS CONGESTIVE HEART FAILURE (CHF) TERHADAP TN. E DI RUANG FREESIA RSU HANDAYANI KOTABUMI LAMPUNG UTARA TANGGAL 10-12 OKTOBER 2022. Diploma thesis, Poltekkes Kemenkes Tanjungkarang.

ANISA, IRMA (2023) ASUHAN KEPERAWATAN GANGGUAN KEBUTUHAN OKSIGENASI PADA PASIEN EFUSI PLEURA DAN PASIEN CKD DI RUANG ICU RSUD Dr. H. ABDUL MOELOEK TAHUN 2023. Diploma thesis, Poltekkes KemenkesTanjungkarang.

ANISA, RINI PUTRI (2021) ASUHAN KEPERAWATAN GANGGUAN KEBUTUHAN NUTRISI PADA IBU HAMIL TRIMESTER SATU KELUARGA BAPAK A DENGAN HIPEREMESIS GRAVIDARUM DI KELURAHAN WAY HUWI KECAMATAN JATI AGUNG KABUPATEN LAMPUNG SELATAN TAHUN 2021. Diploma thesis, Poltekkes Tanjungkarang.

ANISA INDAH SETIA, NINGRUM (2023) ASUHAN KEPERAWATAN KELUARGA DENGAN GANGGUAN OKSIGENASI TERHADAP AN. E PADA KASUS ASMA DI DESA GUNUNG ANGGER KECAMATAN KOTABUMI SELATAN KABUPATEN LAMPUNG UTARA TANGGAL 08-10 NOVEMBER 2022. Diploma thesis, Poltekkes Kemenkes Tanjungkarang.

ANISAWATI, VIRA (2022) ASUHAN KEPERAWATAN GANGGUAN PEMENUHAN KEBUTUHAN OKSIGENASI PADAPASIEN TUMOR PARU DI RUANG PARU RSUD JENDRAL AHMAD YANI METRO PROVINSI LAMPUNG TAHUN 2022. Diploma thesis, Poltekkes Tanjungkarang.

ANITA, ANITA and Agustanti, Dwi and Purwati, Purwati (2022) KORESPONDENSI : Pijat Refleksi dan Penurunan Intensitas Nyeri pada Pasien Post Operasi Sectio Caesarea. Diploma thesis, Poltekkes Tanjungkarag.

ANITA, ANITA and Agustanti, Dwi and Purwati, Purwati (2022) LAIK ETIK : Pijat Refleksi dan Penurunan Intensitas Nyeri pada Pasien Post Operasi Sectio Caesarea. Diploma thesis, Poltekkes Tanjungkarag.

ANITA, ANITA and Purwati, Purwati and Desmarnita, Ulty (2021) KORESPONDENSI : Book of Stunting Risk Detection and Monitoring Health (DRSMK) and Stunting Prevention Behavior in Children the First 1000 Days of Life. Diploma thesis, Poltekkes Tanjungkarag.

ANITA, ANITA and Purwati, Purwati and Desmarnita, Ulty (2021) LAIK ETIK : Book of Stunting Risk Detection and Monitoring Health (DRSMK) and Stunting Prevention Behavior in Children the First 1000 Days of Life. Diploma thesis, Poltekkes Tanjungkarag.

ANITA, ANITA and Purwati, Purwati and Desmarnita, Ulty (2021) TURNITIN : Book of Stunting Risk Detection and Monitoring Health (DRSMK) and Stunting Prevention Behavior in Children the First 1000 Days of Life. Diploma thesis, Poltekkes Tanjungkarag.

ANITA, ANITA and Purwati, Purwati and Kodri, Kodri and Hernani, Nani (2020) KORESPONDENSI : The Using of The Cone Bag and The Satisfaction of Delivery Assistants in Measuring Post Partum Bleeding. Diploma thesis, Poltekkes Tanjungkarag.

ANITA, ANITA and Purwati, Purwati and Kodri, Kodri and Hernani, Nani (2020) LAIK ETIK : The Using of The Cone Bag and The Satisfaction of Delivery Assistants in Measuring Post Partum Bleeding. Diploma thesis, Poltekkes Tanjungkarag.

ANITA, ANITA and Purwati, Purwati and Kodri, Kodri and Hernani, Nani (2020) TURNITIN : The Using of The Cone Bag and The Satisfaction of Delivery Assistants in Measuring Post Partum Bleeding. Diploma thesis, Poltekkes Tanjungkarag.

ANJANI, GARNIS RANAR (2021) ASUHAN KEPERAWATAN PASIEN DENGAN HIPERTERMIA PADA KASUSKEJANG DEMAM TERHADAP An. R DI RUANGANAK RSUD MAYJEND HM RYACUDU KOTABUMI LAMPUNG UTARA TANGGAL08-09 MARET 2021. Diploma thesis, Poltekkes Tanjungkarang.

ANJANI, SELLA (2023) ASUHAN KEPERAWATAN DENGAN GANGGUAN SENSORI PERSEPSI HALUSINASI PENDENGARAN PADA KASUS SKIZOFRENIA TERHADAP TN. D DI RUANG NURI RUMAH SAKIT JIWA DAERAH PROVINSI LAMPUNG TANGGAL 01-03 APRIL TAHUN 2022. Diploma thesis, Poltekkes Kemenkes Tanjungkarang.

ANJANI, VANI (2023) ASUHAN KEPERAWATAN PASIEN DENGAN GANGGUAN KEBUTUHAN CAIRAN PADA KASUS DHF TERHADAP AN. SDI RUANG EDELWEIS LANTAI II RSU HANDAYANI KOTABUMI LAMPUNG UTARA TANGGAL 20-25 MARET 2023. Diploma thesis, Poltekkes Kemenkes Tanjungkarang.

ANJASMARA, KELVIN (2022) ASUHAN KEPERAWATAN GANGGUAN KEBUTUHAN ISTIRAHAT & TIDUR PADA PASIEN HIPERTENSI DI RUANG E 5 RSUD. A.DADI TJOCKRODIPO BANDAR LAMPUNG TAHUN 2022. Diploma thesis, Poltekkes Tanjungkarang.

ANJELINA, YESI (2021) ASUHAN KEPERAWATAN NYERI KRONIS PADA KELUARGA BAPAK A KHUSUSNYA IBU K PADA TAHAP LANSIA DENGAN HIPERTENSI DI GUNUNG KEMALA TIMUR TAHUN 2021. Diploma thesis, Poltekkes Tanjungkarang.

ANJELITA, TINA (2020) LAPORAN TUGAS AKHIR ASUHAN KEPERAWATAN PASIEN DENGAN GANGGUAN NYERI AKUT PADA KASUS HIPERTENSI TERHADAP Tn. S DI RUANG PENYAKIT DALAM RSUD MAYJEND HM RYACUDU KOTABUMI LAMPUNG UTARA TANGGAL 09 s.d 11 MARET 2020. Diploma thesis, Poltekkes Tanjungkarang.

ANNELIA, RINDI (2022) ASUHAN KEPERAWATAN PERIOPERATIF PADA PASIEN ABSES FEMUR DENGAN TINDAKAN DEBRIDEMEN DI RUMAH SAKIT MARDI WALUYO KOTA METRO TAHUN 2022. Diploma thesis, Poltekkes Tanjungkarang.

ANNISA, NADYA ULFA (2022) HUBUNGAN DUKUNGAN SOSIAL DENGAN PENERIMAAN DIRI PADA PASIEN POST OPERASI MASTEKTOMI DI RSUD DR. H. ABDUL MOELOEK PROVINSI LAMPUNG TAHUN 2022. Diploma thesis, Poltekkes Tanjungkarang.

ANNISA, NADYA ULFA (2023) IMPLEMENTASIEDUKASI PADA PASIEN DENGAN MASALAHKEPERAWATAN GANGGUAN CITRA TUBUHPOST OPERASI MASTEKTOMI DI RS BHAYANGKARA POLDA LAMPUNG. Diploma thesis, Poltekkes Kemenkes Tanjungkarang.

ANTIKA, FIFI (2021) ASUHAN KEPERAWATAN PASIEN DENGAN GANGGUAN KEBUTUHAN CAIRAN PADA KASUS GASTROENTERITIS TERHADAP Ny. N DI RUANG PENYAKIT DALAM RSD MAYJEND HM RYACUDU KOTABUMI LAMPUNG UTARA TANGGAL 11-13 MARET 2021. Diploma thesis, Poltekkes Tanjungkarang.

ANTIKA, FUJI (2023) ASUHAN KEPERAWATAN DENGAN GANGGUAN OKSIGENASI PADA KASUS TB PARU TERHADAP NY. K DI RUANGAN FRESIA RUMAH SAKIT UMUM HANDAYANI KOTABUMI LAMPUNG UTARA TANGGAL 10-12 OKTOBER 2022. Diploma thesis, Poltekkes Kemenkes Tanjungkarang.

ANTIKA, HERLIS (2023) ASUHAN KEPERAWATAN GANGGUAN PEMENUHAN KEBUTUHAN NYERI DAN KENYAMANAN (NYERI AKUT) PADA PASIEN POST OP GYNECOMASTIA GRANULOMA DAN POST OP GRANULOMA LIANG TELINGA DI RSUD DR.A.DADI TJOKRODIPO TAHUN 2023. Diploma thesis, Poltekkes KemenkesTanjungkarang.

ANTIKA, ISTIATI CICI (2021) ASUHAN KEPERAWATAN PERIOPERATIF DENGAN HEMOROID PADA TN. P DENGAN TINDAKAN OPERASI HEMOROIDEKTOMY DI RUANG OPERASI RSUD Dr. H. BOB BAZAR, SKM KALIANDA TAHUN 2021. Diploma thesis, Poltekkes Tanjungkarang.

ANTIKA, ISTIATI CICI (2020) PENGARUH PENDIDIKAN KESEHATAN KAGEL EXERCISE DENGAN MEDIA BOOKLET TERHADAP PENGETAHUAN PADA PASIEN PRE OPERASI SALURAN KEMIH DI RSUD DR. H. ABDUL MOELOEK PROVINSI LAMPUNG TAHUN 2020. Diploma thesis, Poltekkes Tanjungkarang.

APCHATIKA, NA’ILAH GIFIRIA (2023) FAKTOR-FAKTOR YANG BERHUBUNGAN DENGAN PERILAKU PERAWAT DALAM PENERAPAN SURGICAL SAFETY CHECKLIST DI IBS RSUD Dr. H. ABDUL MOELOEK PROVINSI LAMPUNG TAHUN 2023. Diploma thesis, Poltekkes Kemenkes Tanjungkarang.

APRESIA, AMANDA YURIKE (2021) ASUHAN KEPERAWATAN GANGGUAN KEBUTUHAN RASA AMAN NYAMANPADA TN. A DENGAN KASUS LUKA BAKAR DI INSTALASI GAWAT DARURAT RSUD JENDRAL AHMAD YANI METRO TANGGAL 30 MARET 2021. Diploma thesis, Poltekkes Tanjungkarang.

APRIALDO, DANI (2022) ASUHAN KEPERAWATAN GANGGUAN KEBUTUHAN SIRKULASI PADA PASIEN DENGAN ANEMIA DI RSUD JENDERAL AHMAD YANI KOTA METRO LAMPUNG TAHUN 2022. Diploma thesis, Poltekkes Tanjungkarang.

APRIANDHINI, ANINDYA IDA (2022) ASUHAN KEPERAWATAN GANGGUAN KEBUTUHAN OKSIGENASI PADA PASIEN DENGAN PENYAKIT PARU OBSTRUKTIF KRONIK DI RSUD JENDRAL AHMAD YANI METRO TAHUN 2022. Diploma thesis, Poltekkes Tanjungkarang.

APRILIA, ICHA (2021) ASUHAN KEPERAWATAN DENGAN GANGGUAN KEBUTUHAN CAIRAN PADA KASUS HIPEREMESIS GRAVIDARUM TERHADAP Ny. S DI RUANG KEBIDANAN RSUD MAYJEND HM RYACUDU KOTA BUMI LAMPUNG UTARA, TANGGAL 08-10 MARET 2021. Diploma thesis, Poltekkes Tanjungkarang.

APRILIA, ISMI (2022) ASUHAN KEPERAWATAN GANGGUAN KEBUTUHAN OKSIGENASI PADA PASIEN CHRONIC KIDNEY DISEASE DI RUANG PENYAKIT DALAM B RSUD JENDERAL AHMAD YANI METRO PROVINSI LAMPUNG TAHUN 2022. Diploma thesis, Poltekkes Tanjungkarang.

APRILIA, MELSI (2022) ASUHAN KEPERAWATAN GANGGUAN KEBUTUHAN NYERI DAN KENYAMANAN DENGAN POST OPERASI HERNIA INGUINALIS DI RS TK IV 02.07.04 DENKESYAH LAMPUNG TAHUN 2022. Diploma thesis, Poltekkes Tanjungkarang.

APRILIA, NADIAH WINDY AYU (2021) ASUHAN KEPERAWATAN NYERI KRONIS PADA KELUARGA BAPAK S KHUSUSNYA ANAK A PADA TAHAP USIA DEWASA DENGAN GASTRITIS DI KELURAHAN SUKAMENANTI KECAMATAN KEDATON BANDAR LAMPUNG TAHUN 2021. Diploma thesis, Poltekkes Tanjungkarang.

APRILIA, SYERINA (2021) ASUHAN KEPERAWATAN GANGGUAN KEBUTUHAN OKSIGENASI PADA PRASEKOLAH ANAK A DENGAN PENYAKIT ISPA KELUARGA BAPAK R DI KELURAHAN TANJUNG AMAN KECAMATAN KOTABUMI SELATAN KABUPATEN LAMPUNG UTARA TAHUN 2021. Diploma thesis, Poltekkes Tanjungkarang.

APRILIA, YOLA (2022) ASUHAN KEPERAWATAN GANGGUAN KEBUTUHAN NYERI DAN KENYAMAN PADA PASIEN PASCA APENDIKTOMI RS TK IV 02.07.04 DENKESYAH LAMPUNG TAHUN 2022. Diploma thesis, Poltekkes Tanjungkarang.

APRILIA, YULISTA (2020) ASUHAN KEPERAWATAN PERIOPERATIF PADA PASIEN DENGAN TINDAKAN SECTIO CAESARIA (SC) DIRUANG OPERASI RSUD DADI TJOKRODIPO BANDAR LAMPUNG TAHUN 2019. Diploma thesis, Poltekkes Tanjungkarang.

APRILIANI, SHERLY (2021) ASUHAN KEPERAWATAN PASIEN DENGAN GANGGUAN KEBUTUHAN RASA AMAN NYAMAN PADA KASUS POST OPERASI APENDIKTOMI TERHADAP TN.U DIRUANG BEDAH RSD MAYJEND HM RYACUDU KOTABUMI LAMPUNG UTARA TANGGAL 11-13 MARET 2021. Diploma thesis, Poltekkes Tanjungkarang.

APRILIZA, HAPPY CECE (2023) ASUHAN KEPERAWATAN PASIEN DENGAN GANGGUAN MOBILITAS FISIK PADA KASUS POST SECTIO CAESAREA TERHADAP Ny.V DI RUANG KEBIDANAN RSU HANDAYANI KOTABUMI LAMPUNG UTARA TANGGAL 14 – 16 MARET 2023. Diploma thesis, Poltekkes Kemenkes Tanjungkarang.

APRILLIA, HESTI RIZKA (2020) ASUHAN KEPERAWATAN GANGGUAN PEMENUHAN KEBUTUHAN PSIKOSOSIAL HALUSINASI PADA PASIEN SKIZOFRENIA DI RUMAH SAKIT JIWA PROVINSI LAMPUNG TAHUN 2020. Diploma thesis, Poltekkes Tanjungkarang.

APRITANIA, MAYANG DWI (2020) ASUHAN KEPERAWATAN GANGGUAN KEBUTUHAN SIRKULASI PADA ANAK DENGAN THALASEMIA DI RUANG ANAK RSUD JEND. AHMAD YANI KOTA METRO TAHUN 2020. Diploma thesis, Poltekkes Tanjungkarang.

APRIYANI, TOMI (2022) ASUHAN KEPERAWATAN GANGGUAN KEBUTUHAN CAIRAN: HIPOVOLEMIA PADA PASIEN DENGUE HAEMORRHAGIC FEVER DI RUANG KAMELIA RUMAH SAKIT DKT BANDAR LAMPUNG TAHUN 2022. Diploma thesis, Poltekkes Tanjungkarang.

APRIYANSYAH, APRIYANSYAH (2022) ASUHAN KEPERAWATAN PASIEN DENGAN GANGGUAN KEBUTUHAN OKSIGENASI PADA KASUS FRAKTUR COSTAE TERHADAP Tn.I DI IGD RSUD JENDRAL AHMAD YANI KOTA METRO TANGGAL 09 NOVEMBER 2021. Diploma thesis, Poltekkes Tanjungkarang.

APRIYANTI, RATNA (2021) ASUHAN KEPERAWATAN GANGGUAN KEBUTUHAN ISTIRAHAT DAN TIDUR PADA IBU S KELUARGA BAPAK N DENGAN DIABETES MELITUS DI DESA PURWODADI, KABUPATEN LAMPUNG TENGAH TAHUN 2021. Diploma thesis, Poltekkes Tanjungkarang.

APRIYANTI, SILVIA (2023) ASUHAN KEPERAWATAN PASIEN DENGAN GANGGUAN OKSIGENASI PADA KASUS TB PARU TERHADAP NY. D DI RUANG PARU RSD MAYJEND HM RYACUDU KOTABUMI LAMPUNG UTARA TANGGAL 19 S.D 21 OKTOBER 2022. Diploma thesis, Poltekkes Kemenkes Tanjungkarang.

APRIYANTI, TRI YANA (2021) ASUHAN KEPERAWATAN NYERI KRONIS PADA KELUARGA BAPAK N KHUSUSNYA IBU H DENGAN GOUT ARTHRITIS TAHAP LANSIA DI DESA TALANG JAWA KECAMATAN MERBAU MATARAM LAMPUNG SELATAN TAHUN 2021. Diploma thesis, Poltekkes Tanjungkarang.

APRIYANTO, DONI (2020) ASUHAN KEPERAWATAN GANGGUAN PEMENUHAN KEBUTUHAN RASA NYAMAN (NYERI) PADA PASIEN SUSPEK PERITONITIS DI RUANG PENYAKIT DALAM PRIA RSUD PRINGSEWU PROVINSI LAMPUNG TAHUN 2020. Diploma thesis, Poltekkes Tanjungkarang.

APRIYANTO, DONI (2023) ASUHAN KEPERAWATAN POST OPERASI MIOMA UTERIGANGGUAN NYERI AKUT DENGAN INTERVENSITEKNIKRELAKSASINAFAS DALAM DI RSUD Dr. H ABDOEL MOELOEKPROVINSI LAMPUNG TAHUN 2023. Diploma thesis, Poltekkes Kemenkes Tanjungkarang.

ARDI, JONI (2021) ASUHAN KEPERAWATAN PERIOPERATIF PADA PASIEN PERITONITIS DENGAN TINDAKAN LAPARATOMI DI INSTALASI BEDAH SENTRAL RSUD. Dr. H. ABDUL MOELOEK PROVINSI LAMPUNG TAHUN 2021. Diploma thesis, Poltekkes Tanjungkarang.

ARDIANSYAH, DAFA (2022) ASUHAN KEPERAWATAN GANGGUAN PEMENUHAN KEBUTUHAN TERMOREGULASI: HIPERTERMIA PADA PASIEN DEMAM BERDARAH DENGUE (DBD) DI RUANG KARMELIA RUMAH SAKIT DKT DENKESYAH BANDAR LAMPUNG TAHUN 2022. Diploma thesis, Poltekkes Tanjungkarang.

ARDIANSYAH, HENDY (2022) ASUHAN KEPERAWATAN GANGGUAN KEBUTUHAN NUTRISI PADA PASIEN DIABETES MELITUS DI RUMAH SAKIT TK IV 02.07.04 DENKESYAH 02.04.03 LAMPUNG TAHUN 2022. Diploma thesis, Poltekkes Tanjungkarang.

ARIANI, INDIRA (2021) ASUHAN KEPERAWATAN PERIOPERATIF PADA KEHAMILAN PRESBODENGANTINDAKAN SECTIO CAESAREADI RS BHAYANGKARA POLDA LAMPUNG TAHUN 2021. Diploma thesis, Poltekkes Tanjungkarang.

ARIANTA, I PUTU (2021) ASUHAN KEPERAWATAN PERIOPERATIF PADA PASIEN PERITONITIS DENGAN TINDAKAN LAPARATOMI DI RUANG INSTALASI BEDAH CENTRAL RUMAH SAKIT MENGGALA TULANG BAWANG. Diploma thesis, Poltekkes Tanjungkarang.

ARIANTI, ERSA ALIEFIA (2022) ASUHAN KEPERAWATAN PERIOPERATIF PADA PASIEN CHOLELITHIASIS DENGAN TINDAKAN KOLESISTEKTOMI LAPAROSKOPI DI RSUD JENDRAL AHMAD YANI METRO TAHUN 2022. Diploma thesis, Poltekkes Tanjungkarang.

ARIFAINI, FITRI NUR (2020) ASUHAN KEPERAWATAN PERIOPERATIF PADA PASIEN SINUSITIS DENGAN TINDAKAN FESS (FUNCTIONAL ENDOSCOPIC SINUS SURGERY) DI RUANG OPERASI RS DKT BANDAR LAMPUNG TAHUN 2020. Diploma thesis, Poltekkes Tanjungkarang.

ARIFUDIN, IMAM (2023) MOBILISASI DINI PADA PASIENPOST OPERASI OPEN REDUCTION INTERNAL FIXATIONFRAKTUR FEMUR DI RUMAHSAKIT URIPSUMOHARJO LAMPUNG TAHUN 2023. Diploma thesis, Poltekkes Kemenkes Tanjungkarang.

ARIFUDIN, MUHAMMAD (2020) ASUHAN KEPERAWATAN GANGGUAN KEBUTUHAN CAIRAN DAN ELEKTROLIT DENGAN MASALAH HIPOVOLEMIK PADA ANAK DEMAM BERDARAH DENGUE (DBD) DI RUANG ALAMANDA RSUD. Dr. H. ABDUL MOELOEK PROVINSI LAMPUNG TAHUN 2020. Diploma thesis, Poltekkes Tanjungkarang.

ARISANDHI, DHIMAS OKTHAVIAN (2023) HUBUNGAN LAMA OPERASI DENGAN KEJADIAN SHIVERING POST OPERASI DI RSUD DR. H. ABDUL MOELOEK PROVINSI LAMPUNG TAHUN 2023. Diploma thesis, Poltekkes KemenkesTanjungkarang.

ARISANDHI, DHIMAS OKTHAVIAN (2023) HUBUNGAN LAMA OPERASI DENGAN KEJADIAN SHIVERING POST OPERASI DI RSUD DR. H. ABDUL MOELOEK PROVINSI LAMPUNG TAHUN 2023. Diploma thesis, Poltekkes KemenkesTanjungkarang.

ARISTIA, ANNISA (2020) ASUHAN KEPERAWATAN PERIOPERATIF PADA PASIEN HERNIA INGUINALIS DENGAN TINDAKAN OPERASI HERNIOTOMY DI RUANG OPERASI RS DKT BANDAR LAMPUNG TAHUN 2020. Diploma thesis, Poltekkes Tanjungkarang.

ARIYATI, RARA SUCI (2023) FAKTOR-FAKTOR YANG BERHUBUNGAN DENGAN PELAKSANAAN DISCHARGE PLANNING OLEH PERAWAT PADA PASIEN POST OPERASI DI RSUD Dr. H. ABDUL MOELOEK PROVINSI LAMPUNG TAHUN 2023. Diploma thesis, Poltekkes KemenkesTanjungkarang.

ARLENA, ARLENA (2020) ASUHAN KEPERAWATAN GANGGUAN KEBUTUHANOKSIGENASI PADA PASIEN TUBERKULOSIS PARU DIRUANG PARU RSUD JENDRAL AHMAD YANI KOTA METRO PROVINSI LAMPUNG TAHUN 2020. Diploma thesis, Poltekkes Tanjungkarang.

ARMELIA, RISKA INTAN (2023) ASUHAN KEPERAWATAN DENGAN GANGGUAN KEBUTUHAN AKTIVITAS DAN ISTIRAHAT PADA Ny. M DAN Ny.M DENGAN RHEUMATOID ARTHRITIS DI DUSUN SRIMULYO 1 DESA PEMANGGILAN KECAMATAN NATAR KABUPATEN LAMPUNG SELATAN TAHUN 2023. Diploma thesis, Poltekkes KemenkesTanjungkarang.

ARROHMAH, CAESARIA (2022) ASUHAN KEPERAWATAN GANGGUAN KEBUTUHAN NUTRISI PADA PASIEN HEPATITIS B DI RUMAH SAKIT BHAYANGKARA POLDA LAMPUNG TAHUN 2022. Diploma thesis, Poltekkes Tanjungkarang.

ARTIKA, SINDI (2023) PENGARUH KOMBINASI TERAPI KOMPRES HANGAT DENGAN AROMATERAPI JASMINE ESSENSIAL OIL TERHADAPPENURUNAN INTENSITASNYERI PADA PASIEN POST OPERASI LAPARATOMI DI RSUD JEND. A. YANI KOTA METRO TAHUN 2023. Diploma thesis, Poltekkes Kemenkes Tanjungkarang.

ARYA, DENI MAKSUM (2023) ASUHAN KEPERAWATAN GANGGUAN KEBUTUHAN RASA NYAMAN PADA PASIEN CONGESTIVE HEART FAILURE (CHF) DI RUANG TULIP RSUD Dr. H. ABDUL MOELOEK PROVINSI LAMPUNG TAHUN 2023. Diploma thesis, Poltekkes Kemenkes Tanjungkarang.

ASFARA, EMMY (2022) ASUHAN KEPERAWATAN PERIOPERATIF PADA PASIEN NEFROLITIASIS DEXTRA DENGAN TINDAKAN BEDAH MAYOR NEFROLITOTOMI DI RUMAH SAKIT MARDI WALUYO METRO TAHUN 2022. Diploma thesis, Poltekkes Tanjungkarang.

ASIH, EVI RESTU (2021) ASUHAN KEPERAWATAN GANGGUAN KEBUTUHAN RASA NYAMAN (NYERI KRONIS) PADA LANSIA IBU N KELUARGA BAPAK S DENGAN GOUT ARTHRITIS DI DESA KAGUNGAN RATU TULANG BAWANG BARAT PROVINSI LAMPUNG TAHUN 2021. Diploma thesis, Poltekkes Tanjungkarang.

ASRI, MARISA YUSRO (2023) HUBUNGAN GAYA KEPEMIMPINAN KEPALA RUANG DENGAN PENERAPAN STANDAR RESIKO INFEKSI OLEH PERAWAT DI RUANG RAWAT INAP BEDAH RSUD DR. H. ABDUL MOELOEK PROVINSI LAMPUNG. Diploma thesis, Poltekkes KemenkesTanjungkarang.

ASRIANI, CAHYA ZILA (2021) ASUHAN KEPERAWATAN GANGGUAN PEMENUHAN KEBUTUHANNUTRISI PADA KELUARGA BAPAK M KHUSUSNYA ANAK V PADA TAHAP CHILD BEARING DENGAN GIZI KURANG DI KEL. KEBUN JERUK KEC. TANJUNGKARANG TIMUR BANDAR LAMPUNG TAHUN 2021. Diploma thesis, Poltekkes Tanjungkarang.

ASSEGHAF, M. IQBAL (2023) HUBUNGAN PENGETAHUAN DAN KETERAMPILAN PERAWAT PERIOPERATIF DENGAN PELAKSANAAN PENDIDIKAN KESEHATAN PADA PROSES DISCHARGE PLANNING DI RSUD Dr. H. ABDUL MOELOEK PROVINSI LAMPUNG TAHUN 2022. Diploma thesis, Poltekkes Kemenkes Tanjungkarang.

ASSEGHAF, M. IQBAL (2023) IMPLEMENTASI TERAPI MUSIK KLASIK PADA PASIEN DENGAN MASALAH KEPERAWATAN NYERI AKUT POST OPERASI HERNIORAPHY DI RUMAH SAKIT MARDI WALUYO METRO TAHUN 2023. Diploma thesis, Poltekkes Kemenkes Tanjungkarang.

ASTARI, ASTRID DEVI (2022) ASUHAN KEPERAWATAN PERIOPERATIF PADA PASIEN SUBDURAL HEMATOMA KRONIK PERICALVARIA FRONTOTEMPORAL DEKSTRA DENGAN TINDAKAN OKLUSI KRANIOTOMI DI RSUD JENDERAL AHMAD YANI METRO TAHUN 2022. Diploma thesis, Poltekkes Tanjungkarang.

ASTARINI, DEWI APRILIA (2021) GAMBARAN SANITASI LINGKUNGAN RUMAH PADA PENDERITA STUNTING DI WILAYAH PUSKESMAS BRANTI RAYA LAMPUNG SELATAN TAHUN 2020. Diploma thesis, Poltekkes Tanjungkarang.

ASTRADA, ROCKY (2021) ASUHAN KEPERAWATAN GANGGUAN AMAN NYAMAN: NYERI AKUT PADA KASUS POSTOPERASI VESIKOLITHIASIS TERHADAP Tn. D DI RUANG FRESIA LANTAI III RUMAH SAKIT UMUM HANDAYANI KOTABUMI LAMPUNG UTARA TANGGAL 12-13 MARET 2021. Diploma thesis, Poltekkes Tanjungkarang.

ASTUTI, EMMY PUJI (2020) ASUHAN KEPERAWATAN PERIOPERATIF PADA PASIEN APPENDICITIS DENGAN TINDAKAN OPERASI LAPARATOMI EKSPLORASI DI RUMAH SAKIT PERTAMINA BINTANG AMIN PROVINSI LAMPUNG. Diploma thesis, Poltekkes Tanjungkarang.

ASTUTI, RIANTIKA DWI (2021) ASUHAN KEPERAWATAN GANGGUAN KEBUTUHAN OKSIGENASI PADA KELUARGA TN. W KHUSUSNYA AN. R DENGAN ISPA DI KELURAHAN KALIAWI KOTA BANDAR LAMPUNG TAHUN 2021. Diploma thesis, Poltekkes Tanjungkarang.

ASTUTI, SILVIA RIZKI MAI (2021) ASUHAN KEPERAWATAN JIWA DENGAN GANGGUAN SENSORI PERSEPSI: HALUSINASI PENDENGARAN PADA KASUS SKIZOFRENIA TERHADAP Tn. D DI WILAYAH KERJA PUSKESMAS KOTABUMI II KABUPATEN LAMPUNG UTARA TANGGAL 8-10 MARET 2021. Diploma thesis, Poltekkes Tanjungkarang.

ATIKA, ANIS (2021) ASUHAN KEPERAWATAN PASIEN DENGAN GANGGUAN OKSIGENASI PADA KASUS TUBERKULOSIS PARU TERHADAP TN.M DI RUANG PARU RSD MAYJEND HM RYACUDU KOTABUMI LAMPUNG UTARA TANGGAL 08 s.d 10 Maret 2021. Diploma thesis, Poltekkes Tanjungkarang.

AULIA, ADE PUTRI (2023) FAKTOR-FAKTOR YANG MEMPENGARUHI KEPATUHAN PERAWAT DALAM MELAKSANAKAN STANDAR PROSEDUR OPRASIONAL PENCEGAHAN RISIKO JATUH PADA PASIEN POST OPERASI DI RSUD DR.H. ABDUL MOELOEK. Diploma thesis, Poltekkes KemenkesTanjungkarang.

AULIA, SUCI MAUDY (2021) ASUHAN KEPERAWATAN PERIOPERATIF TRANSURETHRAL RESECTION PROSTATE (TURP) PADA PASIEN BENIGNA PROSTAT HIPERPLASIA DI RUMAH SAKIT YUKUM MEDICAL CENTER TAHUN 2021. Diploma thesis, Poltekkes Tanjungkarang.

AUORORA, OLA VANIA (2020) ASUHAN KEPERAWATAN GANGGUAN KEBUTUHAN RASA NYAMAN NYERI PADA PASIEN POST OP CA. MAMMAE DI RUANG MAWAR RSUD Dr. H. ABDUL MOELOEK PROVINSI LAMPUNG TAHUN 2020. Diploma thesis, Poltekkes Tanjungkarang.

AWALIYAH, ZULHIKMAH (2022) ASUHAN KEPERAWATAN PERIOPERATIF PADA PASIEN IMPAKSI GIGI DENGAN TINDAKAN ODONTEKTOMI DI RUMAH SAKIT YUKUM MEDICAL CENTRE LAMPUNG TENGAH TAHUN 2022. Diploma thesis, Poltekkes Tanjungkarang.

AWALIYAH, ZULHIKMAH (2022) ASUHAN KEPERAWATAN PERIOPERATIF PADA PASIEN IMPAKSI GIGI DENGAN TINDAKAN ODONTEKTOMI DI RUMAH SAKIT YUKUM MEDICAL CENTRE LAMPUNG TENGAH TAHUN 2022. Diploma thesis, Poltekkes Tanjungkarang.

AYU, ATIKA RAHMA (2021) ASUHAN KEPERAWATAN GANGGUAN NYERI KRONIS PADA ANAK REMAJA R KELUARGA BAPAK I DENGAN GASTRITIS DI DESA KESUGIHAN KEC. KALIANDA LAMPUNG SELATAN TAHUN 2021. Diploma thesis, Poltekkes Tanjungkarang.

AYU, SHELLA NESTI (2020) ASUHAN KEPERAWATAN GANGGUAN KEBUTUHAN AKTIVITAS PADA PASIEN POST OPERASI FRAKTUR EKTREMITAS BAWAH DENGAN MASALAH MOBILITAS FISIK DI RUANG GELATIK RUMAH SAKIT UMUM DAERAH Dr. H. ABDUL MOELOEK PROVINSI LAMPUNG TAHUN 2020. Diploma thesis, Poltekkes Tanjungkarang.

AYU, SITI SANJAYA (2023) PENERAPAN KOMPRES HANGAT TERHADAP PENURUNAN SKALA NYERI PADA PASIEN DISPEPSIA DI RUMAH SAKIT BHAYANGKARA POLDA LAMPUNG PROVINSI LAMPUNG TAHUN 2023. Diploma thesis, Poltekkes KemenkesTanjungkarang.

AYUNI, DEWI (2023) ASUHAN KEPERAWATAN GAWAT DARURAT DENGAN GANGGUAN OKSIGENASI PADA KASUS STROKE HEMORRHAGE TERHADAP TN. K DI RUANG IGD RUMAH SAKIT UMUM DAERAH AHMAD YANI METRO TANGGAL 10-12 NOVEMBER 2022. Diploma thesis, Poltekkes Kemenkes Tanjungkarang.

AYUNINGTIAS, ERISA (2023) HUBUNGAN EFIKASI DIRI DENGAN TINGKAT KECEMASAN MAHASISWA PRODI SARJANA TERAPAN KEPERAWATAN DALAM MELAKUKAN PRAKTIK KLINIK BEDAH DI RSUD Dr. H. ABDUL MOELOEK PROVINSI LAMPUNG TAHUN 2023. Diploma thesis, Poltekkes Kemenkes Tanjungkarang.

AYUNINGTYAS, NADHYA (2021) ASUHAN KEPERAWATAN PERIOPERATIF PADA PASIEN FRAKTUR FIBULA DENGAN TINDAKAN ORIF (OPEN REDUCTION INTERNAL FIXATION) DI RSUD BOB BAZAR LAMPUNG SELATAN TAHUN 2021. Diploma thesis, Poltekkes Tanjungkarang.

AYUNINGTYAS, NADHYA (2020) PENGARUH BIBLIOTERAPI “TERUSLAH SEMANGAT NADI” TERHADAP STRES HOSPITALISASI ANAK PRA OPERASI DI RSUD Dr. H. ABDUL MOELOEK PROVINSI LAMPUNG TAHUN 2020. Diploma thesis, Poltekkes Tanjungkarang.

AZ ZAHRA, P FADHILLA (2023) ASUHAN KEPERAWATAN JIWA DENGAN KEBUTUHAN PSIKOSOSIAL PADA PASIEN ISOLASI SOSIAL DI RUANG MELATI RUMAH SAKIT JIWA PROVINSI LAMPUNG TAHUN 2023. Diploma thesis, Poltekkes KemenkesTanjungkarang.

AZALIA, NESSIE NINA (2023) HUBUNGAN INISIASI MENYUSUI DINI DAN TINGKAT KECEMASAN DENGAN KELANCARAN PRODUKSI ASI PADA IBU POST SECTIO CAESAREA DI RSUD dr. H. BOB BAZAR, SKM TAHUN 2023. Diploma thesis, Poltekkes KemenkesTanjungkarang.

AZHARI, HAFIT (2020) ASUHAN KEPERAWATAN GANGGUAN PEMENUHAN KEBUTUHAN BELAJAR PADA KELUARGA DENGAN BAHAYA PERILAKU ONANI PADA REMAJA PRIA DI WILAYAH KERJA PUSKESMAS NATAR LAMPUNG SELATAN TAHUN 2020. Diploma thesis, Poltekkes Tanjungkarang.

AZHARI, HAFIT (2023) ASUHAN KEPERAWATAN PADA PASIEN POST OP TRANSURETHRAL RESECTION PROSTATE DENGAN INTERVENSI MOBILISASI DINI DI RSUD JENDRAL AHMAD YANI KOTA METRO TAHUN 2023. Diploma thesis, Poltekkes Kemenkes Tanjungkarang.

AZIZ, MUHAMAD ANGGER ALIF RAHMAN (2021) ASUHAN KEPERAWATAN GANGGUAN PEMENUHAN KEBUTUHAN KESELAMATAN DAN KEAMANAN PADA ANAK V KELUARGA BAPAK A DENGAN KATARAK DI DESA BANARJOYO KECAMATAN BATANGHARI LAMPUNG TIMUR TAHUN 2021. Diploma thesis, Poltekkes Tanjungkarang.

AZIZAH, YENI NUR JAMIL (2023) PENGARUH TERAPI MUROTTAL AL QUR’AN SURAH MARYAM TERHADAP KECEMASAN PASIEN PRE OPERASI SECTIO CAESAREA DI RSIA ANUGERAH MEDICAL CENTER DI KOTA METRO TAHUN 2023. Diploma thesis, Poltekkes KemenkesTanjungkarang.

AZZAHRA, AYU (2021) ASUHAN KEPERAWATAN NYERI KRONIS PADA KELUARGA BAPAK J KHUSUSNYA BAPAK J PADA TAHAP LANSIA DENGAN GOUT ARTHRITIS DI PERUMAHAN BUKIT KEMILING PERMAIKECAMATAN KEMILING BANDAR LAMPUNG TAHUN 2021. Diploma thesis, Poltekkes Tanjungkarang.

AZZAHRA, ULFA (2022) ASUHAN KEPERAWATAN PERIOPERATIF PADA PASIEN DENGAN DIAGNOSA MEDIS VESIKOLITHIASIS DENGAN TINDAKAN VESIKOLITOTOMI DI RSUD DR. H. ABDUL MOELOEK PROVINSI LAMPUNG TAHUN 2022. Diploma thesis, Poltekkes Tanjungkarang.

Achjar, Komang Ayu Henny and Agustanti, Dwi and Paras, Sri Astiti Padma and Pandin, Moses Glorino Rumambo (2018) Knowledge, Attitude, And Skill Of Family To Treat Elderly With Diabetes Mellitus At Home Through The Empowerment Of Elderly Cadre In Lampung. Diploma thesis, Poltekkes Tanjungkarang.

Afifah, Hasna (2021) Asuhan Kebidanan Nifas Dengan Pengeluaran ASI Tidak Lancar Ditempat Praktik Mandiri Bidan Kecamatan Kalirejo, Lampung Tengah Tahun 2021. Diploma thesis, Poltekkes Tanjungkarang.

Agung, Fictor yusman and Aprina, Aprina and Astuti, Titi (2021) Effectiveness of foot massage on sleep quality among post-surgical patients in Dr. H Abdul Moeloek Hospital, Lampung-Indonesia. Diploma thesis, Poltekkes Tanjungkarang.

Agung, Fictor yusman and Aprina, Aprina and Astuti, Titi (2020) Effectiveness of foot massage on sleep quality among post-surgical patients in Dr. H Abdul Moeloek Hospital, Lampung-Indonesia. Diploma thesis, Poltekkes Tanjungkarang.

Agung, Fictor yusman and Aprina, Aprina and Astuti, Titi (2020) KORESPONDENSI : Effectiveness of foot massage on sleep quality among post-surgical patients in Dr. H Abdul Moeloek Hospital, Lampung-Indonesia. Diploma thesis, Poltekkes Tanjungkarag.

Agustanti, Dwi (2021) Knowledge, Attitude, And Skill Of Family To Treat Elderly With Diabetes Mellitus At Home Through The Empowerment Of Elderly Cadre In Lampung. Diploma thesis, Poltekkes Tanjungkarang.

Agustanti, Dwi (2021) Knowledge, Attitude, And Skill Of Family To Treat Elderly With Diabetes Mellitus At Home Through The Empowerment Of Elderly Cadre In Lampung. Diploma thesis, Poltekkes Tanjungkarang.

Agustanti, Dwi and ANITA, ANITA and Purwati, Purwati and Kodri, Kodri (2022) KORESPONDENSI : Jaminan Kesehatan Nasional (JKN) dan Kepuasan Layanan Kesehatan Reproduksi National Health Insurance and Reproductive Health Service Satisfaction. Diploma thesis, Poltekkes Tanjungkarag.

Agustanti, Dwi and ANITA, ANITA and Purwati, Purwati and Kodri, Kodri (2022) LAIK ETIK : Jaminan Kesehatan Nasional (JKN) dan Kepuasan Layanan Kesehatan Reproduksi National Health Insurance and Reproductive Health Service Satisfaction. Diploma thesis, Poltekkes Tanjungkarag.

Agustanti, Dwi and Astini, Yuni (2017) Pengaruh Edukasi Batuk Efektif terhadap Perilaku Batuk Efektif Pasien Post Operasi dengan Anestesi Umum. Diploma thesis, Poltekkes Tanjungkarang.

Agustanti, Dwi and Astini, Yuni (2017) Pengaruh Edukasi Batuk Efektif terhadap Perilaku Batuk Efektif Pasien Post Operasi dengan Anestesi Umum. Diploma thesis, Poltekkes Tanjungkarang.

Agustanti, Dwi and Purbianto, Purbianto (2019) Effect of Alkaline Water Consumption on Decreasing Blood Sugar Levels of Diabetes Mellitus Patients. Diploma thesis, Poltekkes Tanjungkarang.

Agustanti, Dwi and Purbianto, Purbianto (2019) Effect of Alkaline Water Consumption on Decreasing Blood Sugar Levels of Diabetes Mellitus Patients. Diploma thesis, Poltekkes Tanjungkarang.

Agustanti, Dwi and Purbianto, Purbianto (2019) Effect of Alkaline Water Consumption on Decreasing Blood Sugar Levels of Diabetes Mellitus Patients. Diploma thesis, Poltekkes Tanjungkarang.

Agustanti, Dwi and Purbianto, Purbianto (2019) Effect of Alkaline Water Consumption on Decreasing Blood Sugar Levels of Diabetes Mellitus Patients. Diploma thesis, Poltekkes Tanjungkarang.

Agustanti, Dwi and Rihiantoro, Tori and Purbianto, Purbianto (2022) Community Preparedness in Dealing with Tsunami Disasters in Coastal Areas. Diploma thesis, Poltekkes Tanjungkarang.

Agustanti, Dwi and Rihiantoro, Tori and Purbianto, Purbianto (2022) Community Preparedness in Dealing with Tsunami Disasters in Coastal Areas. Diploma thesis, Poltekkes Tanjungkarang.

Agustanti, Dwi and Rihiantoro, Tori and Purbianto, Purbianto (2022) Community Preparedness in Dealing with Tsunami Disasters in Coastal Areas. Diploma thesis, Poltekkes Tanjungkarang.

Agustanti, Dwi and Rihiantoro, Tori and Purbianto, Purbianto (2022) Community Preparedness in Dealing with Tsunami Disasters in Coastal Areas. Diploma thesis, Poltekkes Tanjungkarang.

Agustanti, Dwi and Rihiantoro, Tori and Purbianto, Purbianto (2022) Community Preparedness in Dealing with Tsunami Disasters in Coastal Areas. Diploma thesis, Poltekkes Tanjungkarang.

Aini, Kurratu (2021) Asuhan Keperawatan Gangguan Kebutuhan Nyeri Kronis Pada Anak E Keluarga Bapak B Dengan Gastritis Di Kelurahan Kelapa Tiga Tanjungkarang Pusat Kota Bandar Lampung Tahun 2021. Diploma thesis, Poltekkes Tanjungkarang.

Ainy, Syarifah (2023) GAMBARAN PENGETAHUAN MASYARAKAT TENTANG PEMAKAIAN GIGI TIRUAN DI DESA PASURUAN KECAMATAN PENENGAHAN LAMPUNG SELATAN TAHUN 2023. Diploma thesis, Poltekkes Kemenkes Tanjungkarang.

Aldo, Aldo (2021) ASUHAN KEPERAWATAN GANGGUAN NYERI PADA IBU S KELUARGA BAPAK S DENGAN HIPERTENSI DI DESA MADANG BAWAH RT/RW08/03 KOTAAGUNG TANGGAMUS TAHUN 2021. Diploma thesis, Poltekkes Tanjungkarang.

Aliyanto, Waljidin and Rosmadewi, Rosmadewi (2022) Pengaruh Pengembangan Model Suami Siaga terhadap Dukungan Suami pada Pelaksanaan Inisiasi Menyusu Dini. Diploma thesis, Poltekkes Tanjung Karang.

Aliyanto, Warjidin and Putriana, Yeyen (2015) FAKTOR IBU DAN JANIN YANG MEMPENGARUHI KEJADIAN ASFIKSIA. Diploma thesis, Poltekkes Tanjungkarang.

Aliyanto, Warjidin and Putriana, Yeyen (2015) FAKTOR IBU DAN JANIN YANG MEMPENGARUHI KEJADIAN ASFIKSIA. Diploma thesis, Poltekkes Tanjungkarang.

Aliyanto, Warjidin and Rosmadewi, Rosmadewi (2019) Efektifitas Sayur Pepaya Muda dan Sayur Daun Kelor terhadap Produksi ASI pada Ibu Post Partum Primipara. Diploma thesis, Poltekkes Tanjungkarang.

Amaliah, Fitri (2021) ASUHAN GIZI TERSTANDAR PADA PASIEN DIABETES MELITUS TIPE 2 DI RSUD PESAWARAN PROVINSI LAMPUNG TAHUN 2021. Diploma thesis, Poltekkes Tanjungkarang.

Amar, Renata (2022) ASUHANKEPERAWATANPASIENDENGAN GANGGUANKEBUTUHAN NUTRISIPADAKASUSSTUNTINGTERHADAP An. ADI WILAYAH KERJA PUSKESMAS KOTABUMI IILAMPUNGUTARA TANGGAL 8-10 MARET 2022. Diploma thesis, Poltekkes Tanjungkarang.

Anggraeini, Dwi Amalia (2021) ASUHAN KEPERAWATAN PERIOPERATIF PADA PASIEN CARSINOMA BULI DENGAN TINDAKAN SISTOSKOPI DI RUANG IBS Dr. H. ABDUL MOELOK PROVINSI LAMPUNG TAHUN 2021. Diploma thesis, Poltekkes Tanjungkarang.

Anggraini, Yetti and Islamiyati, Islamiyati and Sumiyati, Sumiyati and Ekawati, Irma Wahyuni (2020) Acupressure therapy as a pain reliever for dysmenorrhea. Diploma thesis, Poltekkes Tanjungkarang.

Angraini, Salsabila Putri (2022) ASUHAN KEPERAWATAN KELUARGA TERHADAP INDIVIDU NY.R DENGAN GANGGUAN OKSIGENISASI PADA KASUS ASMA BRONIALDI WILAYAH KERJA PUSKESMAS KOTABUMI II KABUPATEN LAMPUNG UTARA TANGGAL 21-23 FEBRUARI 2O22. Diploma thesis, Poltekkes Tanjungkarang.

Angraini, Salsabila Putri (2022) ASUHAN KEPERAWATAN KELUARGA TERHADAP INDIVIDU NY.R DENGAN GANGGUAN OKSIGENISASI PADA KASUS ASMA BRONIALDI WILAYAH KERJA PUSKESMASKOTABUMI II KABUPATEN LAMPUNG UTARA TANGGAL 21-23 FEBRUARI 2O22. Diploma thesis, Poltekkes Tanjungkarang.

Anjani, garnis ranar (2021) ASUHAN KEPERAWATAN PASIEN DENGAN HIPERTERMIA PADA KASUS KEJANG DEMAM TERHADAP An. R DI RUANG ANAK RSUD MAYJEND HM RYACUDU KOTABUMI LAMPUNG UTARA TANGGAL 08-09 MARET 2021. Diploma thesis, Poltekkes tanjungkarang.

Aprina, Aprina (2022) Physical Activity and Blood Sugar Levels in People with Diabetes Mellitus: Evidence from Indonesia. Diploma thesis, Poltekkes Tanjungkarang.

Aprina, Aprina and Ardiansyah, Novri and Sunarsih, Sunarsih (2019) KORESPONDENSI : Terapi Bermain Puzzle pada Anak Usia 3-6 tahun terhadap Kecemasan Pra Operasi. Diploma thesis, Poltekkes Tanjungkarag.

Aprina, Aprina and Ardiansyah, Novri and Sunarsih, Sunarsih (2019) LAIK ETIK : Terapi Bermain Puzzle pada Anak Usia 3-6 tahun terhadap Kecemasan Pra Operasi. Diploma thesis, Poltekkes Tanjungkarag.

Aprina, Aprina and Ardiansyah, Novri and Sunarsih, Sunarsih (2019) TURNITIN : Terapi Bermain Puzzle pada Anak Usia 3-6 tahun terhadap Kecemasan Pra Operasi. Diploma thesis, Poltekkes Tanjungkarag.

Aprina, Aprina and Ardiansyah, Novri and Sunarsih, Sunarsih (2019) Terapi Bermain Puzzle pada Anak Usia 3-6 tahun terhadap Kecemasan Pra Operasi. Diploma thesis, Poltekkes Tanjungkarang.

Aprina, Aprina and Ardiansyah, Novri and Sunarsih, Sunarsih (2019) Terapi Bermain Puzzle pada Anak Usia 3-6 tahun terhadap Kecemasan Pra Operasi. Diploma thesis, Poltekkes Tanjungkarang.

Aprina, Aprina and Astuti, Titi (2022) Breast Cancer Risk Prevention Model (RICANDRA) to Determine the Risk Factors Associated with the Incidence of Breast Cancer in Women of Childbearing Age in Lampung Province. Diploma thesis, Poltekkes Tanjungkarang.

Aprina, Aprina and Astuti, Titi (2022) Breast Cancer Risk Prevention Model (RICANDRA) to Determine the Risk Factors Associated with the Incidence of Breast Cancer in Women of Childbearing Age in Lampung Province. Diploma thesis, Poltekkes Tanjungkarang.

Aprina, Aprina and Astuti, Titi (2022) Breast Cancer Risk Prevention Model (RICANDRA) to Determine the Risk Factors Associated with the Incidence of Breast Cancer in Women of Childbearing Age in Lampung Province. Diploma thesis, Poltekkes Tanjungkarang.

Aprina, Aprina and Astuti, Titi (2022) Breast Cancer Risk Prevention Model (RICANDRA) to Determine the Risk Factors Associated with the Incidence of Breast Cancer in Women of Childbearing Age in Lampung Province. Diploma thesis, Poltekkes Tanjungkarang.

Aprina, Aprina and Astuti, Titi (2020) Faktor Dominan Perilaku Berisiko terhadap Melahirkan Usia Anak. Diploma thesis, Poltekkes Tanjungkarang.

Aprina, Aprina and Astuti, Titi (2020) Faktor Dominan Perilaku Berisiko terhadap Melahirkan Usia Anak. Diploma thesis, Poltekkes Tanjungkarang.

Aprina, Aprina and Astuti, Titi (2022) KORESPONDENSI : Breast Cancer Risk Prevention Model (RICANDRA) to Determine the Risk Factors Associated with the Incidence of Breast Cancer in Women of Childbearing Age in Lampung Province. Diploma thesis, Poltekkes Tanjungkarag.

Aprina, Aprina and Astuti, Titi (2020) KORESPONDENSI : Faktor Dominan Perilaku Berisiko terhadap Melahirkan Usia Anak. Diploma thesis, Poltekkes Tanjungkarag.

Aprina, Aprina and Astuti, Titi (2022) LAIK ETIK : Breast Cancer Risk Prevention Model (RICANDRA) to Determine the Risk Factors Associated with the Incidence of Breast Cancer in Women of Childbearing Age in Lampung Province. Diploma thesis, Poltekkes Tanjungkarag.

Aprina, Aprina and Astuti, Titi (2020) LAIK ETIK : Faktor Dominan Perilaku Berisiko terhadap Melahirkan Usia Anak. Diploma thesis, Poltekkes Tanjungkarag.

Aprina, Aprina and Astuti, Titi (2020) TURNITIN : Faktor Dominan Perilaku Berisiko terhadap Melahirkan Usia Anak. Diploma thesis, Poltekkes Tanjungkarag.

Aprina, Aprina and Astuti, Titi (2022) TURNITIN: Breast Cancer Risk Prevention Model (RICANDRA) to Determine the Risk Factors Associated with the Incidence of Breast Cancer in Women of Childbearing Age in Lampung Province. Diploma thesis, Poltekkes Tanjungkarag.

Aprina, Aprina and Astuti, Titi and Amatiria, Gustop (2022) KORESPONDENSI : Early Warning System of Cervic Cancer (EWS Ca. CERVIC) In Women of Reliable Age Based on Mobile. Diploma thesis, Poltekkes Tanjungkarag.

Aprina, Aprina and Astuti, Titi and Amatiria, Gustop (2022) LAIK ETIK : Early Warning System of Cervic Cancer (EWS Ca. CERVIC) In Women of Reliable Age Based on Mobile. Diploma thesis, Poltekkes Tanjungkarag.

Aprina, Aprina and Astuti, Titi and Amatiria, Gustop (2022) TURNITINE : Early Warning System of Cervic Cancer (EWS Ca. CERVIC) In Women of Reliable Age Based on Mobile. Diploma thesis, Poltekkes Tanjungkarag.

Aprina, Aprina and Astuti, Titi and sulistianingsih, Eka (2021) KORESPONDENSI : Metabolic Profile of Female Student in Senior High School of Metro City, Lampung, Indonesia. Diploma thesis, Poltekkes Tanjungkarag.

Aprina, Aprina and Astuti, Titi and sulistianingsih, Eka (2021) LAIK ETIK : Metabolic Profile of Female Student in Senior High School of Metro City, Lampung, Indonesia. Diploma thesis, Poltekkes Tanjungkarag.

Aprina, Aprina and Astuti, Titi and sulistianingsih, Eka (2021) Metabolic Profile of Female Student in Senior High School of Metro City, Lampung, Indonesia. Diploma thesis, Poltekkes Tanjungkarang.

Aprina, Aprina and Astuti, Titi and sulistianingsih, Eka (2021) Metabolic Profile of Female Student in Senior High School of Metro City, Lampung, Indonesia. Diploma thesis, Poltekkes Tanjungkarang.

Aprina, Aprina and Astuti, Titi and sulistianingsih, Eka (2021) Metabolic Profile of Female Student in Senior High School of Metro City, Lampung, Indonesia. Diploma thesis, Poltekkes Tanjungkarang.

Aprina, Aprina and Astuti, Titi and sulistianingsih, Eka (2021) Metabolic Profile of Female Student in Senior High School of Metro City, Lampung, Indonesia. Diploma thesis, Poltekkes Tanjungkarang.

Aprina, Aprina and Astuti, Titi and sulistianingsih, Eka (2021) TURNITIN : Metabolic Profile of Female Student in Senior High School of Metro City, Lampung, Indonesia. Diploma thesis, Poltekkes Tanjungkarag.

Aprina, Aprina and Erwandi, Erwandi (2021) Determinants of Failure to Grow on Toddlers (Stunting). Diploma thesis, Poltekkes Tanjungkarag.

Aprina, Aprina and Erwandi, Erwandi (2021) Determinants of Failure to Grow on Toddlers (Stunting). Diploma thesis, Poltekkes Tanjungkarang.

Aprina, Aprina and Erwandi, Erwandi (2021) Determinants of Failure to Grow on Toddlers (Stunting). Diploma thesis, Poltekkes Tanjungkarang.

Aprina, Aprina and Erwandi, Erwandi (2021) Determinants of Failure to Grow on Toddlers (Stunting). Diploma thesis, Poltekkes Tanjungkarang.

Aprina, Aprina and Erwandi, Erwandi (2021) Determinants of Failure to Grow on Toddlers (Stunting). Diploma thesis, Poltekkes Tanjungkarang.

Aprina, Aprina and Erwandi, Erwandi (2021) LAIK ETIK : Determinants of Failure to Grow on Toddlers (Stunting). Diploma thesis, Poltekkes Tanjungkarag.

Aprina, Aprina and Erwandi, Erwandi (2021) TURNITIN: Determinants of Failure to Grow on Toddlers (Stunting). Diploma thesis, Poltekkes Tanjungkarag.

Aprina, Aprina and Prima, Kumara (2021) The Effect of Acupressure and Aromatherapy Therapy to Reduce Frequency Nausea Vomiting in Pregnant. Diploma thesis, Poltekkes Tanjungkarang.

Aprina, Aprina and Rilyani, Rilyani and Parosaliantika, Mela (2021) LAIK ETIK : Pengaruh Postnatal Yoga Terhadap Kualitas Tidur Ibu Postnatal Di Wilayah Kerja Puskesmas Kotabumi II Kabupaten Lampung Utara. Diploma thesis, Poltekkes Tanjungkarag.

Aprina, Aprina and Rilyani, Rilyani and Parosaliantika, Mela (2021) Pengaruh Postnatal Yoga Terhadap Kualitas Tidur Ibu Postnatal Di Wilayah Kerja Puskesmas Kotabumi II Kabupaten Lampung Utara. Diploma thesis, Poltekkes Tanjungkarag.

Aprina, Aprina and Rilyani, Rilyani and Parosaliantika, Mela (2021) Pengaruh Postnatal Yoga Terhadap Kualitas Tidur Ibu Postnatal Di Wilayah Kerja Puskesmas Kotabumi II Kabupaten Lampung Utara. Diploma thesis, Poltekkes Tanjungkarang.

Aprina, Aprina and Rilyani, Rilyani and Parosaliantika, Mela (2021) TURNITIN : Pengaruh Postnatal Yoga Terhadap Kualitas Tidur Ibu Postnatal Di Wilayah Kerja Puskesmas Kotabumi II Kabupaten Lampung Utara. Diploma thesis, Poltekkes Tanjungkarag.

Aprina, Aprina and Rilyani, Rilyani and parasaliantika, Mela (2021) Pengaruh Postnatal Yoga Terhadap Kualitas Tidur Ibu Postnatal Di Wilayah Kerja Puskesmas Kotabumi II Kabupaten Lampung Utara. Diploma thesis, Poltekkes Tanjungkarang.

Aprina, Aprina and Rinaldi, Adittio (2020) KORESPONDENSI : Pengaruh konsumsi musa paradisiaca terhadap produksi ASI pada ibu menyusui. Diploma thesis, Poltekkes Tanjungkarag.

Aprina, Aprina and Rinaldi, Adittio (2020) LAIK ETIK : Pengaruh konsumsi musa paradisiaca terhadap produksi ASI pada ibu menyusui. Diploma thesis, Poltekkes Tanjungkarag.

Aprina, Aprina and Rinaldi, Adittio (2020) Pengaruh konsumsi musa paradisiaca terhadap produksi ASI pada ibu menyusui. Diploma thesis, Poltekkes Tanjungkarang.

Aprina, Aprina and Rinaldi, Adittio (2020) TURNITIN: Pengaruh konsumsi musa paradisiaca terhadap produksi ASI pada ibu menyusui. Diploma thesis, Poltekkes Tanjungkarag.

Aprina, Aprina and Taufiq, Ihsan and sulistianingsih, Eka (2017) Panduan Latihan Berjalan Pada Penderita Diabetes Millitus Tipe 2. Diploma thesis, Poltekkes Tanjungkarag.

Aprina, Aprina and fatonah, siti (2022) KORESPONDENSI : Literatur Review: Efektifitas Kie Terhadap Kesiapan Catin Dalam Menghadapi Kehamilan Pertama. Diploma thesis, Poltekkes Tanjungkarag.

Aprina, Aprina and fatonah, siti (2022) Literatur Review: Efektifitas Kie Terhadap Kesiapan Catin Dalam Menghadapi Kehamilan Pertama. Diploma thesis, Poltekkes Tanjungkarang.

Aprina, Aprina and fatonah, siti (2022) Literatur Review: Efektifitas Kie Terhadap Kesiapan Catin Dalam Menghadapi Kehamilan Pertama. Diploma thesis, Poltekkes Tanjungkarang.

Aprina, Aprina and fatonah, siti (2022) TURNITIN : Literatur Review: Efektifitas Kie Terhadap Kesiapan Catin Dalam Menghadapi Kehamilan Pertama. Diploma thesis, Poltekkes Tanjungkarag.

Aprina, Aprina and prima, kumara (2021) The Effect of Acupressure and Aromatherapy Therapy to Reduce Frequency Nausea Vomiting in Pregnant. Diploma thesis, Poltekkes Tanjungkarang.

Aprina, Aprina and rinaldi, Aditio (2020) Pengaruh konsumsi musa paradisiaca terhadap produksi ASI pada ibu menyusui. Diploma thesis, Poltekkes Tanjungkarang.

Apriyani, Heni and Sono, Sono (2020) DIAPHRAGMATIC BREATHING EXERCISE IMPROVE PULMONARY VENTILATION FUNCTION IN ASTHMA BRONCHIALE PATIENT. Diploma thesis, Poltekkes Tanjungkarag.

Arisinta, Fenike (2022) ASUHAN KEPERAWATAN DENGAN HIPERTERMIA PADA KASUS DENGUE HEMORRHAGIC FEVER (DHF) TERHADAP Tn. H DI RUANG FREESIA RSU HANDAYANI KOTABUMI LAMPUNG UTARA TANGGAL 14-16 MARET 2022. Diploma thesis, Poltekkes Tanjungkarang.

Armis, Aryudhi and Haniastuti, tetiana and Susilowati, heni (2019) The effect of bitter gourd (Momordica charantia) ethanolic extract on inflammatory infiltrates and NF-κB activation in periodontitis. Diploma thesis, Poltekkes Tanjungkarang.

Ayuningtyas, Nadhya and Aprina, Aprina and ANITA, ANITA (2020) KORESPONDENSI : Pengaruh Biblioterapi “Teruslah Semangat Nadi” terhadap Stres Hospitalisasi Anak Pra Operasi. Diploma thesis, Poltekkes Tanjungkarag.

Ayuningtyas, Nadhya and Aprina, Aprina and ANITA, ANITA (2020) TURNITIN : Pengaruh Biblioterapi “Teruslah Semangat Nadi” terhadap Stres Hospitalisasi Anak Pra Operasi. Diploma thesis, Poltekkes Tanjungkarag.

Ayuningtyas, Nadhya and Aprina, Aprina and anita, anita (2020) LAIK ETIK : Pengaruh Biblioterapi “Teruslah Semangat Nadi” terhadap Stres Hospitalisasi Anak Pra Operasi. Diploma thesis, Poltekkes Tanjungkarag.

Ayuningtyas, Nadhya and Aprina, Aprina and anita, anita (2020) Pengaruh Biblioterapi “Teruslah Semangat Nadi” terhadap Stres Hospitalisasi Anak Pra Operasi. Diploma thesis, Poltekkes Tanjungkarang.

Ayuningtyas, Nadhya and Aprina, Aprina and anita, anita (2020) Pengaruh Biblioterapi “Teruslah Semangat Nadi” terhadap Stres Hospitalisasi Anak Pra Operasi. Diploma thesis, Poltekkes Tanjungkarang.

agustia, dede nia (2021) ASUHAN KEPERAWATAN PASIEN DENGAN GANGGUAN OKSIGENASI PADA KASUS TB PARU TERHADAP Tn. K DI RUANG PARU RSD. MAYJEND HM. RYACUDU KOTABUMI LAMPUNG UTARA TANGAL 08-10 MARET 2021. Diploma thesis, Poltekkes tanjungkarang.

B

BAHTIAR, FAJRI (2023) ASUHAN KEPERAWATAN PASIEN DENGAN GANGGUAN OKSIGENASI PADA KASUS ASMA BRONKIAL TERHADAP NY. S DI RUANG PARU RSD MAYJEND HM RYACUDU KOTABUMI LAMPUNG UTARA TANGGAL 10-13 OKTOBER 2022. Diploma thesis, Poltekkes Kemenkes Tanjungkarang.

BAKRI, SITI RAHMA (2022) ASUHAN KEPERAWATAN PERIOPERATIF PADA PASIEN CA MAMMAE DEXTRA DENGAN TINDAKAN KLASIK RADIKAL MASTEKTOMI DI RUMAH SAKIT DR.H ABDUL MOELOEK PROVINSI LAMPUNG TAHUN 2022. Diploma thesis, Poltekkes Tanjungkarang.

BAKRI, SITI RAHMA (2021) HUBUNGAN TINGKAT PENGETAHUAN DENGAN PENERAPAN PERAWAT TENTANG MANAJEMEN NYERI NON FARMAKOLOGI PADA PASIEN POST OPERASI DI RUANG RAWAT INAP BEDAH RSUD JENDERAL AHMAD YANI KOTA METRO PROVINSI LAMPUNG TAHUN 2021. Diploma thesis, Poltekkes Tanjungkarang.

BALQIST, MUTIA PUTRI (2020) ASUHAN KEPERAWATAN GANGGUAN PEMENUHAN KEBUTUHAN PSIKOSOSIAL GANGGUAN MEMORI PADA LANSIA DENGAN DEMENSIA DI UPTD PSLU TRESNA WERDHA NATAR LAMPUNG SELATAN TAHUN 2020. Diploma thesis, Poltekkes Tanjungkarang.

BAMA, EGI YADI RURI (2021) ASUHAN KEPERAWATAN GANGGUAN KEBUTUHAN PERSONAL HYGIENE PADA BAPAK E KELUARGA BAPAK E DENGAN STROKE NON HEMORAGIK DI DESA KENALI KECAMATAN BELALAU KABUPATEN LAMPUNG BARAT TAHUN 2021. Diploma thesis, Poltekkes Tanjungkarang.

BANGSAWAN, MUHAMAD GIGIH (2020) PENGARUH FOOT HAND MASSAGE TERHADAP KECEMASAN PADA PASIEN PREOPERASI DI RUANG KUTILANG RSUD DR. H. ABDUL MOELOEK PROVINSI LAMPUNG TAHUN 2020. Diploma thesis, Poltekkes Tanjungkarang.

BARATAMA, MAHARANY FERYNDA (2021) ASUHAN KEPERAWATAN KELUARGA BAPAK H KHUSUSNYA BAPAK R DENGAN MASALAH KEPERAWATAN GANGGUAN RASA AMAN NYAMAN NYERI PADA PASIEN SCABIES DI DESA NEGARA TULANG BAWANG TAHUN 2021. Diploma thesis, Poltekkes Tanjungkarang.

BAROTO, GUMBREG SUNU (2022) ASUHAN KEPERAWATAN PERIOPERATIF PADA PASIEN NEFROLITIASIS DENGAN TINDAKAN OPEN STONE SURGERY NEPHROLITHOTOMY DI RSUD JENDERAL AHMAD YANI METRO TAHUN 2022. Diploma thesis, Poltekkes Tanjungkarang.

BASIRUN, BERLYANI AGUSTINA (2020) ASUHAN KEPERAWATAN GANGGUAN PEMENUHAN KEBUTUHAN PSIKOSOSIAL RISIKO PERILAKU KEKERASAN PADA PASIEN SKIZOFRENIA DI RUMAH SAKIT JIWA PROVINSI LAMPUNG TAHUN 2020. Diploma thesis, Poltekkes Tanjungkarang.

BATARA, AGIL CAHYA (2023) HUBUNGAN JOB PERFORMANCE DAN WORK ENGAGEMENT DENGAN MANAJEMEN ENERGI PERAWAT DI RSUD DR. H. ABDUL MOELOEK PROVINSI LAMPUNG. Diploma thesis, Poltekkes KemenkesTanjungkarang.

BELIUK, NADIA (2023) ASUHAN KEPERAWATAN GERONTIK TERHADAP TN. N DENGAN GANGGUAN RASA AMAN NYAMAN PADA KASUS HIPERTENSI DI DESA BANDAR PUTIH WILAYAH KERJA PUSKESMAS KOTABUMI II, KABUPATEN LAMPUNG UTARA TANGGAL 15- 17 NOVEMBER 2022. Diploma thesis, Poltekkes Kemenkes Tanjungkarang.

BELLA, MYA SILVIA (2021) ASUHAN KEPERAWATAN GANGGUAN POLA TIDUR PADA KELUARGA BAPAK. T KHUSUSNYA BAPAK. T DI DESA WONOHARJO KABUPATEN TANGGAMUS PROVINSI LAMPUNG TAHUN 2021. Diploma thesis, Poltekkes Tanjungkarang.

BERUTU, INDAH WULANDARI (2023) IMPLEMENTASI TEKNIK RELAKSASI AUTOGENIK PADA PASIEN DENGAN NYERI POST OPERASI OPEN PROSTATECTOMY DI RUANG ANGGREK DI RS MARDI WALUYO. Diploma thesis, Poltekkes Kemenkes Tanjungkarang.

BERUTU, INDAH WULANDARI (2022) PENGARUH TEKNIK RELAKSASI GENGGAM JARI KOMBINASI TEKNIK RELAKSASI NAFAS DALAM TERHADAP PENURUNAN INTENSITAS NYERI PADA PASIEN POST SECTIO CAESAREA DI RSUD Dr. H. ABDUL MOELOEK PROVINSI LAMPUNG DAN RSIA ANUGERAH MEDICAL CENTER KOTA METRO TAHUN 2022. Diploma thesis, Poltekkes Tanjungkarang.

BONITA, SENORITA (2022) ASUHAN KEPERAWATAN PERIOPERATIF PADA PASIEN APPENDICITIS DENGAN TINDAKAN APENDIKTOMI DI RUMAH SAKIT BHAYANGKARA BANDAR LAMPUNG TAHUN 2022. Diploma thesis, Poltekkes Tanjungkarang.

BRAMITA, YOSICA (2022) FAKTOR-FAKTOR YANG BERHUBUNGAN DENGAN KECEMASAN PASIEN PRE OPERASI SEKSIO SESAREA DI RUMAH SAKIT UMUM HANDAYANI KOTABUMI TAHUN 2022. Diploma thesis, Poltekkes Tanjungkarang.

BRAMITA, YOSICA (2023) IMPLEMENTASI TEKNIK RELAKSASI BENSON PADA ASUHAN KEPERAWATAN NYERI PASIEN POST MASTEKTOMIDI RSUD DR. H ABDUL MOELOEK PROVINSI LAMPUNG TAHUN 2023. Diploma thesis, Poltekkes Kemenkes Tanjungkarang.

BREN, SIRLIA SALSABILA (2020) ASUHAN KEPERAWATAN GANGGUAN KEBUTUHAN NUTRISI PADA KELUARGA KHUSUSNYA PADA ANAK DENGAN MALNUTRISI DI WILAYAH KERJA PUSKESMAS RAWAT INAP KEMILING BANDAR LAMPUNG TAHUN 2020. Diploma thesis, Poltekkes Tanjungkarang.

BRILLIANA, RISALAH (2022) ASUHAN KEPERAWATAN PERIOPERATIF PADA PASIEN VESICOLITHIASIS DENGAN TINDAKAN SISTOSKOPI LITOTRIPSI DI RSUD JENDERAL AHMAD YANI METRO TAHUN 2022. Diploma thesis, Poltekkes Tanjungkarang.

BUDIANSYAH, HABIB (2022) ASUHAN KEPERAWATAN PERIOPERATIF PADA PASIEN TUMOR ESOFAGUS PEMASANGAN GASTROSTOMY FEEDING TUBE DENGAN TINDAKAN LAPARATOMI DI RSUD JEND. AHMAD YANI METRO TAHUN 2022. Diploma thesis, Poltekkes Tanjungkarang.

BUDIANTO, BUDIANTO (2021) ASUHAN KEPERAWATAN PERIOPERATIF PADA PASIEN APENDISITIS PERFORASI DENGAN TINDAKAN LAPARATOMI DI RUANG OPERASI RUMAH SAKIT BHAYANGKARA BANDAR LAMPUNG TAHUN 2021. Diploma thesis, Poltekkes Tanjungkarang.

BUDIANTO, BUDIANTO and Agustanti, Dwi and Astini, Yuni (2017) Pengaruh Edukasi Batuk Efektif terhadap Perilaku Batuk Efektif Pasien Post Operasi dengan Anestesi Umum. Diploma thesis, Poltekkes Tanjungkarang.

BUDIMAN, RADEN (2023) ASUHAN KEPERAWATAN GANGGUAN KEBUTUHAN OKSIGENASI PADA PASIEN BRONKOPNEUMONIA DI RUANG ALAMANDA RSUD DR. H. ABDUL MOELOEK PROVINSI LAMPUNG TAHUN 2023. Diploma thesis, Poltekkes KemenkesTanjungkarang.

Baini, Arinda (2023) ASUHAN KEPERAWATAN KELUARGA DENGAN GANGGUAN RASA NYAMAN PADA KASUS GASTRITIS TERHADAP INDIVIDU NY. I DI WILAYAH KERJA PUSKESMAS KOTABUMI II LAMPUNG UTARA TANGGAL 31 OKTOBER - 4 NOVEMBER 2022. Diploma thesis, Poltekkes Kemenkes Tanjungkarang.

Baiti, Nur (2022) ASUHAN KEPERAWATAN DENGAN GANGGUAN OKSIGENASI PADA KASUS ANEMIA TERHADAP Ny. S DI RUANG FRESIA RSU HANDAYANI KOTABUMI LAMPUNG UTARA TANGGAL 02-04 MARET 2022. Diploma thesis, Poltekkes Tanjungkarang.

Bakti, Putri Andini and ANITA, ANITA (2022) KORESPONDENSI : Obesitas Sentral terhadap Kadar Gula Darah Postprandial pada Pegawai Laki-Laki Dewasa di Lingkungan Kerja. Diploma thesis, Poltekkes Tanjungkarag.

Bangsawan, Merah and Murhan, Al and Widodo, Widodo (2018) Dukungan Keluarga dan Koping Stres pada Lansia yang Mengalami Masalah Kesehatan Fisik di Satu Desa pada Kabupaten Lampung Selatan. Diploma thesis, Poltekkes Tanjungkarang.

Bangsawan, Merah and Murhan, Al and Widodo, Widodo (2018) Dukungan Keluarga dan Koping Stres pada Lansia yang Mengalami Masalah Kesehatan Fisik di Satu Desa pada Kabupaten Lampung Selatan. Diploma thesis, Poltekkes Tanjungkarang.

Bertalina, Bertalina (2015) HUBUNGAN ASAM LEMAK JENUH, TAK JENUH GANDA DAN SERAT DENGAN RASIO LDL/HDL PADA PENDERITA JANTUNG KORONER DI POLI JANTUNG RSUD Dr. HI. ABDUL MOELOEK. Diploma thesis, Poltekkes Tanjungkarang.

Bertalina, Bertalina and Antun, Rahmadi and Hasan, Amrul (2017) The Effect of Nutritional Counseling to Changes in the Behavior of Consuming Various Food and Physical Activity in Obese Children. Diploma thesis, Poltekkes Tanjungkarang.

Bertalina, Bertalina and Muliani, muliani (2016) Hubungan Pola Makan, Asupan Makanan dan Obesitas Sentral dengan Hipertensi di Puskesmas Rajabasa Indah Bandar Lampung. Diploma thesis, Poltekkes Tanjungkarang.

Bertalina, Bertalina and Mulyani, Roza (2020) Pengaruh Pemberdayaan Keluarga terhadap Pengendalian Obesitas. Diploma thesis, Poltekkes Tanjungkarang.

Bertalina, Bertalina and Purnama, Purnama (2016) Hubungan Lama Sakit, Pengetahuan, Motivasi Pasien dan Dukungan Keluarga dengan Kepatuhan Diet Pasien Diabetes Mellitus. Diploma thesis, Poltekkes Tanjungkarang.

Bertalina, Bertalina and Rahmadi, Antun (2021) PENDAMPINGAN IBU HAMIL DI DESA FOKUS STUNTING KABUPATEN LAMPUNG TIMUR. Diploma thesis, Poltekkes Tanjungkarang.

Bertalina, Bertalina and an, suryani (2017) Hubungan Asupan Natrium, Gaya Hidup, dan Faktor Genetik dengan Tekanan Darah pada Penderita Penyakit Jantung Koroner. Diploma thesis, Poltekkes Tanjungkarang.

Bertalina, Bertalina and anindiyati, Anindiyati (2016) Hubungan Pengetahuan Terapi Diet dengan Indeks Glikemik Bahan Makanan yang Dikonsumsi Pasien Diabetes Mellitus. Diploma thesis, Poltekkes Tanjungkarang.

C

CAHYA SAPUTRA, DICKY (2022) ASUHAN KEPERAWATAN GAWAT DARURAT DENGAN GANGGUAN SIRKULASI PADA KASUS CONGESTIVE HEART FAILURE (CHF) TERHADAP TN. M DI RUANG IGDRSUD JENDERAL AHMAD YANI METRO TANGGAL 21 FEBRUARI 2022. Diploma thesis, Poltekkes Tanjungkarang.

CAHYANI, ANNISA REGITA (2023) ASUHAN KEPERAWATAN DENGAN GANGGUAN PEMENUHAN KEBUTUHAN RASA NYAMAN PADA PASIEN HIPERTENSI DI DESA SRIMULYO PEMANGGILAN NATAR LAMPUNG SELATAN TAHUN 2023. Diploma thesis, Poltekkes KemenkesTanjungkarang.

CAHYANI, DEWI (2023) ASUHAN KEPERAWATAN GANGGUAN KEBUTUHAN NYERI DAN KENYAMANAN PADA PASIEN DENGAN POST OPERASI TONSILEKTOMI DI RUMAH SAKIT TK IV 02.07.04 DENKESYAH 02.04.03 LAMPUNG TAHUN 2023. Diploma thesis, Poltekkes KemenkesTanjungkarang.

CAHYANI, LINTANG INDAH (2023) ASUHAN KEPERAWATAN GANGGUAN NYERI AKUT PADA PASIEN LIMFOMA MALIGNA DI RUANG PENYAKIT DALAM NON INFEKSIUS RSUD Dr. H. ABDUL MOELOEK PROVINSI LAMPUNG TAHUN 2023. Diploma thesis, Poltekkes KemenkesTanjungkarang.

CAHYANI, PUTRI REGITA (2023) ASUHAN KEPERAWATAN GANGGUAN KEBUTUHAN OKSIGENASI PADA PASIEN PENYAKIT PARU OBSTRUKSI KRONIK (PPOK) DI RUANG PARU RSUD DR. A. DADI TJOKRODIPO LAMPUNG TAHUN 2023. Diploma thesis, Poltekkes KemenkesTanjungkarang.

CAHYANINGRUM, APRILIA (2021) ASUHAN KEPERAWATAN PERIOPERATIF PADA PASIEN APPENDICITIS DENGAN TINDAKAN OPERASI APENDIKTOMI DI RUANG OPERASI RSUD BOB BAZAR KALIANDA TAHUN 2021. Diploma thesis, Poltekkes Tanjungkarang.

CAHYANINGRUM, APRILIA (2020) PENGARUH GUIDED IMAGERY TERHADAP KUALITAS TIDUR KLIEN PRE OPERASI DI RUANG BEDAH RSUD DR. H. ABDUL MOELOEK PROVINSI LAMPUNG TAHUN 2020. Diploma thesis, Poltekkes Tanjungkarang.

CAHYANINGTIYAS, YOSI (2023) IMPLEMENTASI TEKNIK RELAKSASI GENGGAM JARI DALAM MENGATASI NYERI AKUT PADA PASIEN POSTDEBRIDEMENT ULKUS DIABETIKUM DI RSUD JENDRAL AHMAD YANI KOTA METRO. Diploma thesis, Poltekkes Kemenkes Tanjungkarang.

CAHYANTI, DILA PUTRI (2023) PENGARUH MENGUNYAH PERMEN KARET MENGANDUNG XYLITOL DAN MOBILISASI DINI TERHADAP TIMBULNYA FLATULENSI POST OPERASI DENGAN GENERAL ANESTESI DI RSUD Dr. H. ABDUL MOELOEK PROVINSI LAMPUNG TAHUN 2023. Diploma thesis, Poltekkes KemenkesTanjungkarang.

CARISTA, TIRA (2022) ASUHAN KEPERAWATAN PERIOPERATIF PADA PASIEN NEFROLITIASIS DENGAN TINDAKAN URETEROSCOPIC LITHOTRIPSY (URS) DI RUMAH SAKIT ABDUL MOELOEK TAHUN 2022. Diploma thesis, Poltekkes Tanjungkarang.

CARNELIA, NADILA (2022) ASUHAN KEPERAWATAN GANGGUAN KEBUTUHAN OKSIGENASI PADA PASIEN CONGESTIFE HEART FAILURE DIRSUD Dr. A. DADI TJOKRODIPO PROVNSI LAMPUNG TAHUN 2022. Diploma thesis, Poltekkes Tanjungkarang.

CAROLIN, LAURA FITRYA (2021) ASUHAN KEPERAWATAN DENGAN HIPERVOLEMIA PADA KASUS GAGAL GINJAL KRONIK TERHADAP NY. D DI RUANG PENYAKIT DALAM RSUD MAYJEND HM. RYACUDU KOTABUMI LAMPUNG UTARA TANGGAL 08-10 MARET 2021. Diploma thesis, Poltekkes Tanjungkarang.

CAROLINA, ALDA (2021) ASUHAN KEPERAWATAN DENGAN GANGGUAN TERMOREGULASI PADA KASUS KEJANG DEMAM TERHADAPAn. A DI RUANG EDELWEIS LANTAI 2 RS HANDAYANI KOTABUMI LAMPUNG UTARA TANGGAL 11-13 MARET 2021. Diploma thesis, Poltekkes Tanjungkarang.

CESARIA, FEBRI ANI (2023) FAKTOR – FAKTOR YANG BERHUBUNGAN DENGAN PELAKSANAAN MOBILISASI DINI PADA PASIEN POST OPERASI FRAKTUR FEMUR DI RSUD Dr. H. ABDUL MOELOEK PROVINSI LAMPUNG TAHUN 2023. Diploma thesis, Poltekkes KemenkesTanjungkarang.

CESARITA, ANEZ ADINDA (2022) ASUHAN KEPERAWATAN JIWA DENGAN GANGGUAN PERSEPSI SENSORI: HALUSINASI PENDENGARAN PADA KASUS SKIZOFRENIA TERHADAP Tn. D DI RUANG NURI RUMAH SAKIT JIWA DAERAH PROVINSI LAMPUNG TANGGAL 22-27 MARET 2021. Diploma thesis, Poltekkes Tanjungkarang.

CHAFIFAH, LISTIANI NUR (2023) ASUHAN KEPERAWATAN PASIEN POST URETEROSCOPIC LITHOTRIPSY (URS) DENGAN MASALAH KEPERAWATAN NAUSEA (PONV)MELALUI INTERVENSI MOBILISASI DINI DI RSUD JENDERAL AHMAD YANI KOTA METRO TAHUN 2023. Diploma thesis, Poltekkes Kemenkes Tanjungkarang.

CHANDRA, ROBBY ADI (2021) ASUHAN KEPERAWATAN PASIEN DENGAN GANGGUAN RASA AMAN NYAMAN PADA KASUS HIPERTENSI TERHADAP Ny.I DI WILAYAH KERJA PUSKESMAS KOTABUMI II LAMPUNG UTARATANGGAL 23-25 MARET 2021. Diploma thesis, Poltekkes Tanjungkarang.

CHRISTIAN, FRITZ DIMAS (2021) ASUHAN KEPERAWATAN GANGGUAN PENURUNAN KESADARAN PADA KASUS CEDERA KEPALA BERAT TERHADAP TN. R DI IGD RSUD. AHMAD YANI KOTA METRO. Diploma thesis, Poltekkes Tanjungkarang.

CINTIA, AYU (2022) ASUHAN KEPERAWATAN PERIOPERATIF PADA PASIEN STRUMA NODUSA NON TOXIC DENGAN TINDAKAN ISMOLOBEKTOMI DI RUANG OPERASI RUMAH SAKIT BHAYANGKARA POLDA LAMPUNG TAHUN 2022. Diploma thesis, Poltekkes Tanjungkarang.

CLARISYA, GERRY (2022) ASUHAN KEPERAWATAN PERIOPERATIF PADA PASIEN TONSILITIS DENGAN TINDAKAN TONSILEKTOMI DIRUANG OPERASI RUMAH SAKIT BHAYANGKARA POLDA LAMPUNG TAHUN 2022. Diploma thesis, Poltekkes Tanjungkarang.

Casey-Lockeyer, Mary and Osman, Malina and Somronthong, Ratana and Afiyanti, Yati (2020) Proceeding Biennial International Conference Safe Community. In: ICSC 2020.

Chandra, Reza Adi (2021) ASUHAN KEPERAWATAN GANGGUAN RASA NYAMAN CEMAS TERHADAP KELUARGA BAPAK H KHUSUSNYA IBU D PASCA ABORTUS DI DESA SUKAJADI LAMPUNG TENGAH TAHUN 2021. Diploma thesis, Poltekkes Tanjungkarang.

cahyanti, dian (2021) ASUHAN KEPERAWATAN JIWA DENGAN GANGGUAN PERSEPSI SENSORI: HALUSINASI PENDENGARAN PADA KASUS SKIZOFRENIA TERHADAP Ny.L DI WILAYAH KERJA PUSKESMAS KOTABUMI II KABUPATEN LAMPUNG UTARA TANGGAL 08-11 MARET 2021. Diploma thesis, Poltekkes tanjungkarang.

D

DAMAYANTI, NI NYOMAN CYNTIA (2022) ASUHAN KEPERAWATAN PERIOPERATIF PADA PASIEN APENDISITIS DENGAN TINDAKAN LAPAROTOMI EXPLORASI DI RUMAH SAKIT MARDI WALUYO METRO TAHUN 2022. Diploma thesis, Poltekkes Tanjungkarang.

DAMAYANTI, PUTRI ANGELINA (2023) ASUHAN KEPERAWATAN PASIEN DENGAN MASALAH GANGGUAN PERSEPSI SENSORI : HALUSINASI PENDENGARAN PADA KASUS SKIZOFRENIA TERHADAP Ny.R DI RUANG MELATIRUMAH SAKIT JIWADAERAH PROVINSI LAMPUNG TANGGAL 14-16 MARET 2022. Diploma thesis, Poltekkes Kemenkes Tanjungkarang.

DAMAYATI, MEIZA (2020) ASUHAN KEPERAWATAN DENGAN GANGGUAN PEMENUHAN KEBUTUHAN AKTIVITAS FISIK PADA PASIEN STROKE DI RUANG SYARAF RSUD JEND. A YANI KOTA METRO PROVINSI LAMPUNG TAHUN 2020. Diploma thesis, Poltekkes Tanjungkarang.

DAMERIA, DAMERIA (2023) ASUHAN KEPERAWATAN NYERI AKUT DENGAN PENERAPAN RELAKSASI GENGGAM JARI PADA PASIEN POST OPERASI HERNIOTOMY DI RUMAH SAKIT BHAYANGKARA BANDAR LAMPUNG. Diploma thesis, Poltekkes Kemenkes Tanjungkarang.

DARIYATI, DARIYATI (2021) ASUHAN KEPERAWATAN PERIOPERATIF PADA PASIEN APENDIKSITIS PERFORASI DENGAN TINDAKAN LAPARATOMY EKSPLORASI DIRUMAH SAKIT MENGGALA TAHUN 2021. Diploma thesis, Poltekkes Tanjungkarang.

DARMAWAN, TUAH MEIDIYANTI (2021) ASUHAN KEPERAWATAN GANGGUAN KEBUTUHAN KETIDAKNYAMANAN PASCA PARTUM PADA IBU M KELUARGA BAPAK S DENGAN EPISIOTOMI DI DESA SUKAJAYA LEMPASING KABUPATEN PESAWARAN TAHUN 2021. Diploma thesis, Poltekkes Tanjungkarang.

DELIANI, RIMA (2022) ASUHAN KEPERAWATAN GANGGUAN KEBUTUHAN OKSIGENASI PADA PASIEN Tn. S DENGAN POST OPERASI CRANIOTOMY EC. HEMORAGIK INTRASEREBRAL DI RUANG ICU RSUD JENDRAL AHMAD YANI METRO TAHUN 2022. Diploma thesis, Poltekkes Tanjungkarang.

DELLA, CINDY RATNA (2022) ASUHAN KEPERAWATAN GANGGUAN KEBUTUHAN NYERI DAN KENYAMANAN PADA PASIEN CHEPALGIA DI RUANG SYARAF RSUD JENDRAL AHMAD YANI KOTA METRO PROVINSI LAMPUNG TAHUN 2022. Diploma thesis, Poltekkes Tanjungkarang.

DENATA, RENDA (2021) ASUHAN KEPERAWATAN GANGGUAN PEMENUHAN KEBUTUHAN RASA NYAMAN NYERI PADA KELUARGA BAPAK P. KHUSUSNYA NN. R. DENGAN GASTRITIS DI DESA MARGA AGUNG LAMPUNG SELATAN TAHUN 2021. Diploma thesis, Poltekkes Tanjungkarang.

DESFRIYANTI, DHEA (2021) ASUHAN KEPERAWATAN ANAK DENGAN GANGGUAN KEBUTUHAN NUTRISI PADA KASUS STUNTING TERHADAP An.A DI WILAYAH KERJA PUSKESMAS BATANGHARI KABUPATEN LAMPUNG TIMUR TANGGAL 22-24 MARET 2021. Diploma thesis, Poltekkes Tanjungkarang.

DEVI ASTARI, ASTRID (2022) ASUHAN KEPERAWATAN PERIOPERATIF PADA PASIEN SUBDURAL HEMATOMA KRONIK PERICALVARIA FRONTOTEMPORAL DEKSTRA DENGAN TINDAKAN OKLUSI KRANIOTOMI DI RSUD JENDERAL AHMAD YANI METRO TAHUN 2022. Diploma thesis, Poltekkes Tanjungkarang.

DEWANGGA, KADEK BAGUS (2021) ASUHAN KEPERAWATAN GANGGUAN KERUSAKAN INTEGRITAS KULIT PADA BAPAK K KELUARGA BAPAK K DENGAN DERMATITIS KONTAK ALERGI DI DESA RAMA DEWA KECAMATAN SEPUTIH RAMAN KABUPATEN LAMPUNG TENGAH TAHUN 2021. Diploma thesis, Poltekkes Tanjungkarang.

DEWI, CLARA CHINTIA (2020) ASUHAN KEPERAWATAN GANGGUAN KEBUTUHAN AKTIVITAS PADA PASIEN FRAKTUR EKSTREMITAS BAWAH DI RUANG BEDAH RSUD JENDRAL AHMAD YANI METRO TAHUN 2020. Diploma thesis, Poltekkes Tanjungkarang.

DEWI, DEBBY CHINTIA (2020) ASUHAN KEPERAWATAN KELUARGA LANSIA DENGAN GANGGUAN PEMENUHAN KEBUTUHAN RASA NYAMAN NYERI PADA LANSIA HIPERTENSI DI KELURAHAN SEGALAMIDER KECAMATAN TANJUNGKARANG BARAT BANDAR LAMPUNG. Diploma thesis, Poltekkes Tanjungkarang.

DEWI, DESAK NYOMAN INDRA (2022) FAKTOR-FAKTOR YANG BERHUBUNGAN DENGAN RETENSI URINE PASCA OPERASI DI POLIKLINIK BEDAH RSUD Dr. H. ABDUL MOELOEK PROVINSI LAMPUNG TAHUN 2022. Diploma thesis, Poltekkes Tanjungkarang.

DEWI, DESAK NYOMAN INDRA (2023) STUDI KASUS PADA IBU PASCA SEKSIO SESAREA DENGAN MASALAH MENYUSUI TIDAK EFEKTIF DI RUMAH SAKIT BHAYANGKARA. Diploma thesis, Poltekkes Kemenkes Tanjungkarang.

DEWI, DESTA KUMALA (2021) ASUHAN KEPERAWATAN GANGGUAN KEBUTUHAN NYERI AKUT PADA ANAK DEWASA ANAK DO KELUARGA BAPAK M DENGAN HEMOROID DI DESA SUMBER AGUNG KABUPATEN PRINGSEWU TAHUN 2021. Diploma thesis, Poltekkes Tanjungkarang.

DEWI, DINA KUSUMA (2022) ASUHAN KEPERAWATAN GANGGUAN KEBUTUHAN PENYULUHAN DAN PEMBELAJARAN PADA PASIEN PASCAOPERASI HEMOROID DI RUANG BEDAH (E4) RSUD dr. A. DADI TJOKRODIPO PROVINSI LAMPUNG TAHUN 2022. Diploma thesis, Poltekkes Tanjungkarang.

DEWI, GUSTIANA SATRA (2020) PENGARUH TERAPI MUSIK KLASIK MOZART TERHADAP PENINGKATAN TEKANAN DARAH DAN DENYUT JANTUNG PADA PASIEN PASCA OPERASI DENGAN ANASTESI UMUM DI RSUD Dr. H ABDUL MOELOEK PROVINSI LAMPUNG TAHUN 2020. Diploma thesis, Poltekkes Tanjungkarang.

DEWI, KARTIKA CANDRA (2022) ASUHAN KEPERAWATAN PERIOPERATIF PADA PASIEN DENGAN DIAGNOSA MEDIS TUMOR HEPAR SEGMEN 6, 7, 8 DENGAN TINDAKAN OPERASI SECTIONECTOMY SEGMENT 6 NON ANATOMICAL DI RSUD DR.H.ABDUL MOELOEK PROVINSI LAMPUNG TAHUN 2022. Diploma thesis, Poltekkes Tanjungkarang.

DEWI, LIDIA ELVANA (2021) ASUHAN KEPERAWATAN PERIOPERATIFPADA PASIEN DENGAN HERNIA INGUINALIS DENGANTINDAKAN OPERASI HERNIAREPAIRDI RUMAH SAKIT ALIMUDIN UMAR LAMPUNG BARAT TAHUN 2021. Diploma thesis, Poltekkes Tanjungkarang.

DEWI, LIDIA ELVANA (2020) PERBEDAAN EFEKTIFITAS GINGER AROMATERAPY DAN TEKNIK RELAKSASI AUTOGENIK TERHADAP PENURUNAN MUAL MUNTAH PASIEN POST OPERASI DENGAN GENERAL ANESTESI RSUD DR. H. ABDUL MOELOEK PROVINSI LAMPUNG TAHUN 2020. Diploma thesis, Poltekkes Tanjungkarang.

DEWI, NI KETUT RATNA (2023) ASUHAN KEPERAWATAN GANGGUAN INTEGRITAS JARINGAN DENGAN PEMBERIAN POLYHEXAMETHYLENE DAN MADU PADA PASIEN POST DEBRIDEMENT ULKUS DIABETIKUM DI RUMAH SAKIT MARDI WALUYO PADA TAHUN 2023. Diploma thesis, Poltekkes Kemenkes Tanjungkarang.

DEWI, NI KETUT RATNA (2020) ASUHAN KEPERAWATAN GANGGUAN KEBUTUHAN OKSIGENASI PADA PASIEN CHF DI RUMAH SAKIT UMUM DAERAH JEND. AHMAD YANI KOTA METRO PROVINSI LAMPUNG TAHUN 2020. Diploma thesis, Poltekkes Tanjungkarang.

DEWI, NURMANISA (2022) ASUHAN KEPERAWATAN ANAK DENGAN GANGGUAN OKSIGENASI PADA KASUS ASMA TERHADAP An. A DI DESA MULANG MAYA KECAMATAN KOTABUMI SELATAN KABUPATEN LAMPUNG UTARA 07-09 MARET 2022. Diploma thesis, Poltekkes Tanjungkarang.

DEWI, PUTU SARI (2020) ASUHAN KEPERAWATAN GANGGUAN KEBUTUHAN NUTRISI PADA IBU HAMIL TRIMESTER III DENGAN KEKURANGAN ENERGI KRONIS DI PUSKESMAS RAWAT INAP KEMILING KOTA BANDAR LAMPUNG TAHUN 2020. Diploma thesis, Poltekkes Tanjungkarang.

DHITA, TIARA (2021) ASUHAN KEPERWATAN KELUARGA TERHADAP Ny. R DENGAN GANGGUAN NYERI AKUT PADA KASUS GASTRITIS DI DESA TANJUNG AMAN KECAMATAN KOTABUMI SELATAN KABUPATEN LAMPUNG UTARA. Diploma thesis, Poltekkes Tanjungkarang.

DIANA, MERALEY (2023) ASUHAN KEPERAWATAN GANGGUAN PEMENUHAN KEBUTUHAN ISTIRAHAT DAN TIDUR PADA PASIEN HIPERTENSI DI DUSUN SRIMULYO 1 DESA PEMANGGILAN KECAMATAN NATAR LAMPUNG SELATAN TAHUN 2023. Diploma thesis, Poltekkes KemenkesTanjungkarang.

DIANI, SERLI (2023) PENGARUH TERAPI RELAKSASI OTOT PROGRESIF TERHADAP TINGKAT KECEMASAN PASIEN PRE OPERASI DI RSUD Dr. H. ABDUL MOELOEK PROVINSI LAMPUNG TAHUN 2023. Diploma thesis, Poltekkes KemenkesTanjungkarang.

DIANSYAH, ROBY (2023) ASUHAN KEPERAWATAN GANGGUAN PEMENUHAN KEBUTUHAN RASA AMAN NYAMAN TERHADAP NY.S DAN TN.T PADA PASIEN HIPERTENSI DI DESA PEMANGGILAN NATAR LAMPUNG SELATAN TAHUN 2023. Diploma thesis, Poltekkes KemenkesTanjungkarang.

DILLA, CHODIZA NASYAHTA (2023) ASUHAN KEPERAWATAN GERONTIK DENGAN GANGGUAN KEBUTUHAN RASA NYAMAN PADA KASUS GOUT ARTHRITIS TERHADAP Ny. F DI DESA KOTA ALAM WILAYAH KERJA PUSKESMAS KOTABUMI II KABUPATEN LAMPUNG UTARA TANGGAL 24-26 OKTOBER 2022. Diploma thesis, Poltekkes Kemenkes Tanjungkarang.

DINASAKTI, ELISA (2023) ASUHAN KEPERAWATAN DENGAN GANGGUAN KEAMANAN DAN PROTEKSI PADA KASUS ULKUS DIABETIKUM TERHADAP NY. C DI RUANG BEDAH RSUD MAYJEND HM RYACUDU KOTABUMI LAMPUNG UTARA TANGGAL 25-27 OKTOBER 2022. Diploma thesis, Poltekkes Kemenkes Tanjungkarang.

DINIANTI, SEVILLA RAIN (2022) ASUHAN KEPERAWATAN PERIOPERATIF PADA IBU INPARTU INDIKASI JANIN MELINTANG DENGAN TINDAKAN SECTIO CAESAREA DI RUMAH SAKIT YUKUM MEDICAL CENTER LAMPUNG TENGAH TAHUN 2022. Diploma thesis, Poltekkes Tanjungkarang.

DIVANILL, ROSSALIA (2020) ASUHAN KEPERAWATAN GANGGUAN KEBUTUHAN AKTIVITAS PADA PASIEN STROKE DI RUANG SYARAF RSUD JEND. AHMAD YANI KOTA METRO TAHUN 2020. Diploma thesis, Poltekkes Tanjungkarang.

DOKTALIA, PUTRI (2023) ASUHAN KEPERAWATAN GERONTIK DENGAN GANGGUAN RASA AMAN NYAMAN PADA KASUS GASTRITIS TERHADAP TN. D DI DESA TANJUNG AMAN KABUPATEN LAMPUNG UTARA WILAYAH KERJA PUSKESMAS KOTABUMI II TANGGAL 14-16 MARET 2023. Diploma thesis, Poltekkes Kemenkes Tanjungkarang.

DOMAS, EBTIO YEZAKI (2023) ASUHAN KEPERAWATAN GANGGUAN KEBUTUHAN OKSIGENASI PADA KASUS ASMA BRONKIAL TERHADAP TN A DI RUANG INSTALASI GAWAT DARURAT RSUD JENDRAL AHMAD YANI METRO LAMPUNG 18 NOVEMBER 2022. Diploma thesis, Poltekkes Kemenkes Tanjungkarang.

DORA, APUTYA AFRIAN (2020) ASUHAN KEPERAWATAN ANAK DENGAN GANGGUAN PROSES BELAJAR PADA ANAK DI SD NEGERI 1 HAJIMENA NATAR LAMPUNG SELATAN. Diploma thesis, Poltekkes Tanjungkarang.

Damayanti, Evita Aisyah (2022) EFEKTIFITAS PENGGUNAAN JAHE DAN MADU DALAM UPAYA MEREDAKAN BATUK DAN MELEGAKAN TENGGOROKAN PADA BALITA DI PMB MARDHATI, S.ST LAMPUNG SELATAN. Diploma thesis, Poltekkes Tanjungkarang.

Dewi, Arum Kusuma (2021) PENGETAHUAN IBU, SIKAP IBU, DAN PERAN PETUGAS KESEHATAN SERTA DUKUNGAN SUAMI TERHADAP PEMBERIAN ASI EKSKLUSIF (STUDI LITERATUR). Diploma thesis, Poltekkes Tanjungkarang.

Diana, Elles (2022) ASUHAN KEBIDANAN PADA IBU BERSALIN UNTUK PENGURANGAN NYERI PERSALINAN KALA 1 FASE AKTIF METODE AROMATERAPI LAVENDER DI TPMB KISWARI HADIMULYO TIMUR METRO PUSAT. Diploma thesis, Poltekkes Tanjungkarang.

Dianna, Ayu Fara (2022) ASUHAN KEPERAWATAN GANGGUAN KEBUTUHAN OKSIGENASI PADA PASIEN DENGAN PENYAKIT PARU OBSTRUKTIF KRONIK DI RSUD JENDRAL AHMAD YANI METRO TAHUN 2022. Diploma thesis, Poltekkes Tanjungkarang.

Dyah P, RR.Ratnasari and Elina Prasetiowati, lies (2015) Pengaruh Konsentrasi Ekstrak Kelopak Bunga Rosella (Hibiscus Sabdariffa) Terhadap Bakteri Streptococcus mutans. Diploma thesis, Poltekkes Tanjungkarang.

Dyah purnomowati, RR. Ratnasari and Elina Prasetiowati, lies (2015) Pengaruh Konsentrasi Ekstrak Kelopak Bunga Rosella (Hibiscus Sabdariffa) Terhadap Bakteri Streptococcus mutans. Diploma thesis, Poltekkes Tanjungkarang.

E

EFENDI, EVITHA ADHE RAHMA (2023) FAKTOR-FAKTOR YANG BERHUBUNGAN DENGAN KEPATUHAN PERAWAT DALAM MELAKSANAKAN FIVE MOMENT HAND HYGIENE DI RUANG BEDAH RSUD DR. H. ABDUL MOELOEK PROVINSI LAMPUNG TAHUN 2023. Diploma thesis, Poltekkes Kemenkes Tanjungkarang.

EFENDI, RIYAN (2021) ASUHAN KEPERAWATAN PASIEN DENGAN GANGGUAN KEAMANAN DAN PROTEKSI PADA KASUS DENGUE HEMORAGIC FEVER ( DHF ) TERHADAP NY. S DI RUANG FRESIA RS HANDAYANI KOTABUMI LAMPUNG UTARA TANGGAL 11–13 MARET 2021. Diploma thesis, Poltekkes Tanjungkarang.

EFRINA, MELIA (2022) ASUHAN KEPERAWATAN DENGAN GANGGUAN KEBUTUHAN CAIRAN PADA KASUS GASTROENTERITISAKUT TERHADAP By.Y DI RUANG EDELWEIS RSU HANDAYANI KOTABUMI LAMPUNG UTARA TANGGAL 28 FEBRUARI – 2 MARET 2022. Diploma thesis, Poltekkes Tanjungkarang.

ELITA, ELITA (2021) ASUHAN KEPERAWATAN GANGGUAN KEBUTUHAN RASA NYERI PADA KELUARGA Tn.N KHUSUSNYA Ny.M PADA TAHAP DEWASA DENGAN HIPERTENSI DI HAJIMENA KECAMATAN NATAR KABUPATEN LAMPUNG SELATAN TAHUN 2021. Diploma thesis, Poltekkes Tanjungkarang.

ELYANI, RENI FEBRI (2022) ASUHANKEPERAWATANPASIENDENGAN GANGGUAN OKSIGENASI PADA KASUS TB PARU TERHADAP NY. SDI RUANGPARURSD MAYJENDHMRYACUDU KOTABUMI LAMPUNG UTARA TANGGAL 21 S.D 23 FEBRUARI 2022. Diploma thesis, Poltekkes Tanjungkarang.

EMIRA, NABILA (2020) ASUHAN KEPERAWATAN GANGGUAN NYERI KRONIK PADA PASIEN KANKER DI RUANG MAWAR RSUD Dr. H. ABDUL MOELOEK PROVINSI LAMPUNG TAHUN 2020. Diploma thesis, Poltekkes Tanjungkarang.

ENDRIANTI, ERICHA (2023) ASUHAN KEPERAWATAN GANGGUAN RASA NYAMAN NYERI AKUT DENGAN INTERVENSI RELAKSASI AUTOGENIK PADA IBUPOST PARTUM SECTIO CAESAREA DI RSUD JENDRAL AHMADYANI KOTA METRO TAHUN 2023. Diploma thesis, Poltekkes Kemenkes Tanjungkarang.

ERFANDA, RAHMAT (2023) ASUHAN KEPERAWATAN DENGAN GANGGUAN OKSIGENASI PADA PASIEN ASMA TERHADAP TN. A DI RUANG FRESIA LANTAI 4 RUMAH SAKIT HANDAYANI KOTABUMI TANGGAL 13-15 NOVEMBER 2022. Diploma thesis, Poltekkes Kemenkes Tanjungkarang.

ERLINAWATI, ERLINAWATI (2023) IMPLEMENTASI AROMATERAPI DENGAN MASALAH KEPERAWATAN ANSIETASPADA PASIEN POST OPERASI VARIKOKEL DIRUMAH SAKIT BHAYANGKARAPOLDALAMPUNG TAHUN2023. Diploma thesis, Poltekkes Kemenkes Tanjungkarang.

ERLIYANI, ERLIYANI (2022) ASUHAN KEBIDANAN PADA IBU HAMIL DENGAN KONSTIPASI DI TPMB DWI SRI ISNAWATI, Amd.Keb PUNGGUR LAMPUNG TENGAH. Diploma thesis, Poltekkes Tanjungkarang.

ERMAWATI, LEKOK (2023) ASUHAN KEPERAWATAN GANGGUAN KEBUTUHAN RASA NYAMAN PADA PASIEN HIPERTENSI DI RUMAH SAKIT BHAYANGKARA POLDA LAMPUNG TAHUN 2023. Diploma thesis, Poltekkes KemenkesTanjungkarang.

ERWIN, ERWIN (2021) ASUHAN KEPERAWATAN GANGGUAN NYERI KRONIS PADA IBU S KELUARGA BAPAK M DENGAN GOUT ARTHRITIS DI DESA PENIANGAN KECAMATAN MARGA SEKAMPUNG KABUPATEN LAMPUNG TIMUR TAHUN 2021. Diploma thesis, Poltekkes Tanjungkarang.

ERYANI, DEVITA RAMA (2020) ASUHAN KEPERAWATAN PERIOPERATIF PADA PASIEN FRAKTUR FEMUR DENGAN TINDAKAN ORIF DIRUANG OK RS. URIP SUMOHARJO PROVINSI LAMPUNG TAHUN 2019. Diploma thesis, Poltekkes Tanjungkarang.

EVILINDA, FARA (2021) ASUHAN KEPERAWATAN PASIEN DENGAN GANGGUAN RASA AMAN NYAMAN PADA KASUS POST PARTUM SPONTAN TERHADAP NY. F DI RUANG KEBIDANAN RSU HANDAYANI KOTABUMI LAMPUNG UTARA 11-13 MARET 2021. Diploma thesis, Poltekkes Tanjungkarang.

Erina, Erina (2019) AsuhanKeperawatan Keluarga dengan Gangguan Pola Nafas Tidak Efektif pada kasus Asma Bronkhial terhadap Individu Ny.S di Wilayah Kerja Puskesmas Kotabumi II. Diploma thesis, Poltekkes Kemenkes Tanjungkarang.

F

FADHILAH, DIAN SHAFA (2020) ASUHAN KEPERAWATAN PERIOPERATIF PADA PASIEN HEMOROID INTERNAL DERAJAT IIIDENGAN TINDAKAN HEMOROIDEKTOMI DI RUANG INSTALASI BEDAH SENTRAL RS PERTAMINA BINTANG AMIN TAHUN 2020. Diploma thesis, Poltekkes Tanjungkarang.

FADILA, ARFINA (2022) ASUHAN KEPERAWATAN GANGGUAN KEBUTUHANOKSIGENASI PADA PASIEN EFUSI PLEURADIRS BHAYANGKARA POLDA LAMPUNG TAHUN 2022. Diploma thesis, Poltekkes Tanjungkarang.

FADILAH, PUTRI (2021) ASUHAN KEPERAWATAN GANGGUAN KEBUTUHAN OKSIGENASI BERSIHAN JALAN NAPAS TIDAK EFEKTIF PADA BAPAK S KELUARGA BAPAK S DENGAN BRONKITIS KRONIS DI DESA KOTA GAJAH KECAMATAN KOTA GAJAH KABUPATEN LAMPUNG TENGAH TAHUN 2021. Diploma thesis, Poltekkes Tanjungkarang.

FADILAH, RIO (2021) GAMBARAN KADAR KOLESTEROL TOTAL PADA PENDERITA HIPERTENSI (STUDI PUSTAKA). Diploma thesis, Poltekkes Tanjungkarang.

FADILLA, NUR (2021) ASUHAN KEPERAWATAN KELUARGA DENGAN GANGGUAN NUTRISI DAN CAIRAN PADA KASUS DIABETES MELITUS TIPE II TERHADAP Ny.S DI WILAYAH DESA GONDANG REJO PEKALONGAN KABUPATEN LAMPUNG TIMUR TANGGAL 24-26 MARET 2021. Diploma thesis, Poltekkes Tanjungkarang.

FADILLAH, KHUSNUL (2021) ASUHAN KEPERAWATAN PASIEN DENGAN GANGGUAN KEBUTUHAN CAIRAN ELEKTROLIT PADA KASUS HIPEREMESIS GRAVIDARUM TERHADAP Ny.Y DI RUANG KEBIDANAN RS HANDAYANI KOTABUMI LAMPUNG UTARA TANGGAL 11-13 MARET 2021. Diploma thesis, Poltekkes Tanjungkarang.

FADIYANTI, MARVA AFRIZA (2023) ASUHAN KEPERAWATAN GANGGUAN KEBUTUHAN AKTIVITAS PADA PASIEN STROKE NON HEMORAGIK DI RS TK.IV.02.07.04 DENKESYAH 02.04.03 KOTA BANDAR LAMPUNG TAHUN 2023. Diploma thesis, Poltekkes Kemenkes Tanjungkarang.

FADLI, DIMAS ADI PRATAMA (2022) ASUHAN KEPERAWATAN GANGGUAN KEBUTUHAN OKSIGENASI PADA PASIEN TUBERKULOSIS PARU DI RUANG KARMELIA RS TK IV 02.07.04 DENKESYAH BANDAR LAMPUNG TAHUN 2022. Diploma thesis, Poltekkes Tanjungkarang.

FAHRA, NAVISA HERMANIA (2023) ASUHAN KEPERAWATAN ANAK DENGAN GANGGUAN KEBUTUHAN RASA NYAMAN PADA KASUS CEDERA KEPALA RINGAN (CKR) TERHADAP An. V DI RUANG EDELWEIS RSU HANDAYANI KOTABUMI LAMPUNG UTARA TANGGAL 4-6 APRIL 2023. Diploma thesis, Poltekkes Kemenkes Tanjungkarang.

FAISAL, MUHAMMAD (2023) ASUHAN KEPERAWATAN PASIEN DENGAN GANGGUAN KEAMANAN & PROTEKTIF POST OPERASI TUTUP STOMA PADA KASUS POST ILEUSTOMY TERHADAP Tn. A DI RUANG BEDAH UMUM RSUD AHMAD YANI METRO TANGGAL 31 OKTOBER - 2 NOVEMBER 2022. Diploma thesis, Poltekkes Kemenkes Tanjungkarang.

FAISYAL, MUHAMMAD (2021) ASUHAN KEPERAWATAN GANGGUAN PEMENUHAN KEBUTUHAN NYERI PADA KELUARGA BAPAK M KHUSUSNYA AN. A DENGAN MASALAH GOUT ARTHRITIS DI DESA SUKAJAYA KOTA BANDAR LAMPUNG TAHUN 2021. Diploma thesis, Poltekkes Tanjungkarang.

FALLAHA, INTAN (2021) ASUHAN KEPERAWATAN KELUARGA DENGAN MASALAH KEBUTUHAN BELAJAR PADA KELUARGA Tn.M DENGAN ANAK USIA SEKOLAH YANG KECANDUAN GADGET DI WILAYAH METRO TIMUR KOTA METRO TAHUN 2021. Diploma thesis, Poltekkes Tanjungkarang.

FANELA, ARIA BELLA (2023) ASUHAN KEPERAWATAN GANGGUAN KEBUTUHAN RASA NYAMAN (NYERI) PADA PASIEN POST OPERASI SOFT TISSUE TUMOR PUNGGUNG DI RUANG MAWAR RUMAH SAKIT DKT BANDAR LAMPUNG TAHUN 2023. Diploma thesis, Poltekkes KemenkesTanjungkarang.

FARADEVA, FARADEVA (2022) ASUHANKEPERAWATANGANGGUANKEBUTUHAN SIRKULASI PADAPASIEN DENGANPENYAKITEVANS SYNDROME DIRUANGPENYAKITDALAMA RSUDJENDERALAHMADYANIKOTAMETRO PROVINSI LAMPUNGTAHUN 2022. Diploma thesis, Poltekkes Tanjungkarang.

FARADINA, SISI (2021) ASUHAN KEPERAWATAN GANGGUAN PERSEPSI SENSORI PADA LANSIA KELUARGA BAPAK M DENGAN GANGGUAN PENDENGARAN DI DESA KESUGIHAN KABUPATEN TANGGAMUS TAHUN 2021. Diploma thesis, Poltekkes Tanjungkarang.

FARAMITA, DELIA (2023) ASUHAN KEPERAWATAN GANGGUAN KEBUTUHAN CAIRAN PADA PASIEN DENGUE HAEMORHAGIC FEVER (DHF) DI RUMAH SAKIT BHAYANGKARA POLDA LAMPUNG TAHUN 2023. Diploma thesis, Poltekkes KemenkesTanjungkarang.

FARIZA, NADILA OKTI (2021) ASUHAN KEPERAWATAN PERIOPERATIF PADA PASIEN G1P0A0 INPARTU KALA 1 MEMANJANG + PRESENTASI KAKI DENGAN TINDAKAN OPERASI SECTIO CAESAREA DI RUMAH SAKIT ALIMUDDIN UMAR LAMPUNG BARAT TAHUN 2021. Diploma thesis, Poltekkes Tanjungkarang.

FARIZA, NADILA OKTI (2020) HUBUNGAN MEAN ARTERI PRESSURE (MAP) DENGAN KEJADIAN POST OPERATIVE NAUSEA AND VOMITING (PONV) PADA PASIEN POST OPERASI BEDAH DENGAN GENERAL ANESTESI DI RSUD Dr. H. ABDUL MOELOEK PROVINSI LAMPUNG. Diploma thesis, Poltekkes Tanjungkarang.

FATIMAH, ISMI (2020) ASUHAN KEPERAWATAN GANGGUAN KEBUTUHAN PSIKOSOSIAL: DEFISIT PERAWATAN DIRI PADA PASIEN SKIZOFRENIA DI RUMAH PENITIPAN PASIEN GANGGUAN JIWA AULIA RAHMA KOTA BANDAR LAMPUNG TAHUN 2020. Diploma thesis, Poltekkes Tanjungkarang.

FATIN, FIRANI LUH (2021) ASUHAN KEPERAWATAN GANGGUAN PEMENUHAN KEBUTUHAN RASA NYAMAN : NYERI PADA KELUARGA TN. S KHUSUSNYA NY. H DI DESA JATIMULYO KABUPATEN LAMPUNG SELATAN TAHUN 2021. Diploma thesis, Poltekkes Tanjungkarang.

FATMAWATI, WIDIA (2023) ASUHAN KEPERAWATAN GANGGUAN KEBUTUHAN RASA NYAMAN PADA KLIEN HIPERTENSI DI DUSUN SRIMULYO 1 DESA PEMANGGILAN KECAMATAN NATAR KABUPATEN LAMPUNG SELATAN TAHUN 2023. Diploma thesis, Poltekkes KemenkesTanjungkarang.

FEBRILIA, TIA (2020) ASUHAN KEPERAWATAN PERIOPERATIF PADA PASIEN COLIC ABDOMEN (ADHESIVE INTESTINAL) DENGAN TINDAKAN LAPARATOMI EKSPLORASI DI RUANG OPERASI RUMAH SAKIT AIRAN RAYA TAHUN 2020. Diploma thesis, Poltekkes Tanjungkarang.

FEBRIYANTI, HERLINA (2023) ASUHAN KEPERAWATAN KELUAGA DENGAN GANGGUAN AKTIVITAS PADA KASUS GOUT ARTHRITIS TERHADAP Ny.S DI DESA BANDAR PUTIH WILAYAH KERJA PUSKESMAS KOTABUMI II KABUPATEN LAMPUNG UTARA TANGGAL 21-23 OKTOBER 2022. Diploma thesis, Poltekkes Kemenkes Tanjungkarang.

FERNANDA, ADITYA JAKA (2022) ASUHAN KEPERAWATAN PERIOPERATIF PADA PASIEN CARSINOMA MAMMAE DENGAN TINDAKAN MASTEKTOMI DI RUMAH SAKIT BHAYANGKARA POLDA LAMPUNG TAHUN 2022. Diploma thesis, Poltekkes Tanjungkarang.

FERNANDA, ADITYA JAKA (2021) PENGARUH HEALTH EDUCATION PEMBEDAHAN DENGAN MEDIA AUDIOVISUAL TERHADAP KECEMASAN PADA PASIEN PRE OPERASI DI RSUD A. YANI METRO PROVINSI LAMPUNG TAHUN 2021. Diploma thesis, Poltekkes Tanjungkarang.

FIRANDA, REFITA (2021) ASUHAN KEPERAWATAN DENGAN GANGGUAN SIRKULASI PADA KASUS PERDARAHAN POST PARTUM TERHADAP NY. K DI RUANG KEBIDANAN RSD MAYJEND HM RYACUDU KOTABUMI LAMPUNG UTARA TANGGAL 8-10 MARET 2021. Diploma thesis, Poltekkes Tanjungkarang.

FIRMANSYAH, AGUNG (2020) ASUHAN KEPERAWATAN GANGGUAN RASA NYAMAN NYERI (Kronis) PADA KLIEN RHEUMATOID ARTHITRIS DI UPTD PSLU TRESNA WERDHA NATARLAMPUNG SELATAN TAHUN 2020. Diploma thesis, Poltekkes Tanjungkarang.

FIRNANDO, MUHAMMAD RIFKI FERY (2023) ASUHAN KEPERAWATAN GANGGUAN MOBILITAS FISIK POST OPERASI LAPARATOMI EKSPLORASI DENGAN PERITONITIS DI RSUD JEND. AHMAD YANI KOTA METRO TAHUN2023. Diploma thesis, Poltekkes Kemenkes Tanjungkarang.

FIRNANDO, MUHAMMAD RIFKI FERY (2022) HUBUNGAN MOTIVASI DAN SELFCARE TERHADAP KUALITAS HIDUP PADA PASIEN POST OPERASI FRAKTUR DI RSUD DR. H. ABDUL MOELOEK PROVINSI LAMPUNG TAHUN 2022. Diploma thesis, Poltekkes Tanjungkarang.

FITRI, GEMA ADELIA (2023) ASUHAN KEPERAWATAN PASIEN DENGAN GANGGUAN SIRKULASI PADA KASUS ANEMIA TERHADAP Ny. B DI RUANG FREESIA RSU HANDAYANI KOTABUMI LAMPUNG UTARA TANGGAL 11-13 OKTOBER 2022. Diploma thesis, Poltekkes Kemenkes Tanjungkarang.

FITRI, INKA SONYA (2021) ASUHAN KEPERAWATAN KELUARGA TN. S DENGAN MASALAH GANGGUAN AKTIVITAS PADA GOUT ARTHRITIS DI WILAYAH KERJA PUSKESMAS KEDATON BANDAR LAMPUNG TAHUN 2021. Diploma thesis, Poltekkes Tanjungkarang.

FITRI, NURUL ANISA (2020) ASUHAN KEPERAWATAN PERIOPERATIF PADA PASIEN RUPTUR TENDON CRURIS DEXTRA DENGAN TINDAKAN REPAIR TENDON DI RUMAH SAKIT AIRAN RAYA PROVINSI LAMPUNG TAHUN 2020. Diploma thesis, Poltekkes Tanjungkarang.

FITRIA, SINDI (2022) ASUHAN KEPERAWATAN KELUARGA PASIEN DENGAN GANGGUAN AMAN NYAMAN PADA KASUS GOUT ARTHRITIS TERHADAP Ny.A DI DESA MULANG MAYA WILAYAH KERJA PUSKESMAS II KOTABUMI KABUPATEN LAMPUNG UTARA TANGGAL 21-25 MARET 2022. Diploma thesis, Poltekkes Tanjungkarang.

FITRIA, WAYAN EKA (2020) ASUHAN KEPERAWATAN PERIOPERATIF PADA PASIEN TRAUMA TUMPUL ABDOMEN DENGAN TINDAKAN LAPARATOMI DI RUANG OK RUMAH SAKIT MARDI WALUYO METRO TAHUN 2019. Diploma thesis, Poltekkes Tanjungkarang.

FITRIANI, RISKA AYU (2022) ASUHAN KEPERAWATAN GANGGUAN KEBUTUHAN OKSIGENASI PADA PASIEN DENGAN (ADHF) ACUTE DECOMPENSATED HEART FAILURE DI RUANG JANTUNG RSUD JENDERAL AHMAD YANI KOTA METRO LAMPUNG TAHUN 2022. Diploma thesis, Poltekkes Tanjungkarang.

FITRIANI, YUNI (2023) ASUHAN KEPERAWATAN PASIEN DENGAN GANGGUAN KEBUTUHAN CAIRAN DAN ELEKTROLIT TERHADAP TN. W PADA KASUS SIROSIS HEPATIS DI RUANG PENYAKIT DALAM B RSUD AHMAD YANI METRO TANGGAL 14-16 NOVEMBER 2022. Diploma thesis, Poltekkes Kemenkes Tanjungkarang.

FITRIANZAH, AMELIYA (2021) ASUHAN KEPERAWATAN GANGGUAN PEMENUHAN KEBUTUHAN OKSIGEN : BERSIHAN JALAN NAPAS TIDAK EFEKTIF, PADA KELUARGA BAPAK H KHUSUSNYA ANAK A DI DESA NEGARA NABUNG LAMPUNG TIMUR. Diploma thesis, Poltekkes Tanjungkarang.

FITRIYANA, ANISA (2020) PENGARUH KOMBINASI TEKNIK TARIK NAPAS DALAM DAN AROMATERAPI LEMON TERHADAP PENURUNAN INTENSITAS NYERI PADA PASIEN POST OPERASI SECTIO CAESAREA DI RUANG BERSALIN RSUD JEND AHMAD YANI METRO PROVINSI LAMPUNG. Diploma thesis, Poltekkes Tanjungkarang.

FITRIYANA, FITRIYANA (2022) ASUHAN KEPERAWATAN PASIEN DENGAN GANGGUAN OKSIGENASI PADA KASUS TB PARU TERHADAPTN.NDI RUANG PARU RSD. MAYJEND HM. RYACUDU KOTABUMI LAMPUNGUTARA 21-24 NOVEMBER 2021. Diploma thesis, Poltekkes Tanjungkarang.

FITRIYANA, FITRIYANA (2021) LAPORAN TUGAS AKHIR ASUHAN KEPERAWATAN PASIEN DENGAN GANGGUAN OKSIGENASI PADA KASUS TB PARU TERHADAP TN. N DI RUANG PARU RSD. MAYJEND HM. RYACUDU KOTABUMI LAMPUNG UTARA 21-24 NOVEMBER 2021. Diploma thesis, Poltekkes Tanjungkarang.

FITRIYANA, LAUDIYA (2020) ASUHAN KEPERAWATAN GANGGUAN KEBUTUHAN OKSIGENASI PADA ANAK DENGAN EFUSI PLEURA DI RUANG ANAK RSUD JEND.AHMAD YANI METRO TAHUN 2020. Diploma thesis, Poltekkes Tanjungkarang.

FITRIYANA, LAUDIYA (2020) ASUHAN KEPERAWATAN GANGGUAN KEBUTUHAN OKSIGENASI PADA ANAK DENGAN EFUSI PLEURA DI RUANG ANAK RSUD JEND.AHMAD YANI METRO TAHUN 2020. Diploma thesis, Poltekkes Tanjungkarang.

FITRIYANI, DEVI (2023) PENGARUH TERAPI KOMPRES HANGAT DAN AROMATERAPI LAVENDER TERHADAP NYERI PADA PASIEN POST OPERASI SECTIO CAESAREA DI RSUD Dr. H. ABDUL MOELOEK PROVINSI LAMPUNG TAHUN 2023. Diploma thesis, Poltekkes Kemenkes Tanjungkarang.

FORTUNA, MUTIARA ADINIL (2023) ASUHAN KEPERAWATAN GANGGUAN KEBUTUHAN TERMOREGULASI PADA PASIEN TYPHOID DI RS BHAYANGKARA POLDA LAMPUNG TAHUN 2023. Diploma thesis, Poltekkes KemenkesTanjungkarang.

FURQONI, FAQIH ALI AKBAR (2023) ASUHAN KEPERAWATAN GANGGUAN KEBUTUHAN AKTIVITAS DAN LATIHAN PADA KLIEN STROKE NON HEMORAGIK DI DUSUN SRIMULYO I DESA PEMANGGILAN KECAMATAN NATAR KABUPATEN LAMPUNG SELATAN PROVINSI LAMPUNG TAHUN 2023. Diploma thesis, Poltekkes KemenkesTanjungkarang.

Fatimah, Siti (2022) ASUHAN KEPERAWATAN GERONTIK DENGAN GANGGUAN KEBUTUHAN AMAN NYAMAN PADA KASUS GOUT ARTHRITIS TERHADAP Tn. M DI DESA BANDAR PUTIH KEC. KOTABUMI SELATAN KABUPATEN LAMPUNG UTARATANGGAL 21-23 FEBRUARI 2022. Diploma thesis, Poltekkes Tanjungkarang.

Febriyani, Ertaviya (2021) GAMBARAN FAKTOR-FAKTOR PARTISIPASI IBU DALAM PENIMBANGAN BALITA DI WILAYAH KERJA PUSKESMAS RAWAT INAP WAY KANDIS BANDAR LAMPUNG TAHUN 2021. Diploma thesis, Poltekkes Tanjungkarang.

Fitri, Eka Yulia and Aprina, Aprina and Setiawati, Setiawati (2019) KORESPONDENSI : Pengaruh Senam Kegel terhadap Penyembuhan Luka pada Ibu Post Partum. Diploma thesis, Poltekkes Tanjungkarag.

Fitri, Eka Yulia and Aprina, Aprina and Setiawati, Setiawati (2019) LAIK ETIK : Pengaruh Senam Kegel terhadap Penyembuhan Luka pada Ibu Post Partum. Diploma thesis, Poltekkes Tanjungkarag.

Fitri, Eka Yulia and Aprina, Aprina and Setiawati, Setiawati (2020) Pengaruh Senam Kegel terhadap Penyembuhan Luka pada Ibu Post Partum. Diploma thesis, Poltekkes Tanjungkarang.

Fitri, Eka Yulia and Aprina, Aprina and Setiawati, Setiawati (2019) TURNITIN : Pengaruh Senam Kegel terhadap Penyembuhan Luka pada Ibu Post Partum. Diploma thesis, Poltekkes Tanjungkarag.

Fitri, Eka Yulia and Aprina, Aprina and Setiwati, Setiawati (2020) Pengaruh Senam Kegel terhadap Penyembuhan Luka pada Ibu Post Partum. Diploma thesis, Poltekkes Tanjungkarang.

Fitroh, Khusnul (2023) GAMBARAN TATA RUANG LABORATORIUM TEKNIK GIGI POLITEKNIK KESEHATAN TANJUNGKARANG. Diploma thesis, Poltekkes KemenkesTanjungkarang.

fahrurozi, fahrurrozi (2021) ASUHAN KEPERAWATAN PASIEN DENGAN GANGGUAN KEBUTUHAN SIRKULASI PADA KASUS THALASEMIA TERHADAP An. D DI RUANG ANAK RSUD MAYJEND HM RYACUDU KOTABUMI LAMPUNG UTARA TANGGAL 11 MARET 2021. Diploma thesis, Poltekkes tanjungkarang.

fitriyana, fitriyana (2021) ASUHAN KEPERAWATAN PASIEN DENGAN GANGGUAN OKSIGENASI PADA KASUS TB PARU TERHADAP TN. N DI RUANG PARU RSD. MAYJEND HM. RYACUDU KOTABUMI LAMPUNG UTARA 21-24 NOVEMBER 2021. Diploma thesis, Poltekkes tanjungkarang.

G

GINANTY, LUCY ANGGUN (2021) ASUHAN KEPERAWATAN GANGGUAN KEBUTUHAN AKTIVITAS PADA KELUARGA TN.S KHUSUSNYA TN.S DENGAN GOUT ATHRITIS DI DESA RATU ABUNG KECAMATAN ABUNG SELATAN KABUPATEN LAMPUNG UTARA TAHUN 2021. Diploma thesis, Poltekkes Tanjungkarang.

GIRI, KOMANG TIARA KORIDEVANI (2023) IMPLEMENTASI AROMATERAPI ESSENTIAL OILLAVENDERPADA PASIEN DENGAN MASALAH NYERI AKUT POST OPERASI APPENDECTOMY DIRS MARDI WALUYO KOTA METRO TAHUN 2023. Diploma thesis, Poltekkes Kemenkes Tanjungkarang.

GIRI, KOMANG TIARA KORIDEVANI (2022) PERBEDAAN WAKTU PELAKSANAAN MOBILISASI DINI TERHADAP WAKTU PULIH PERISTALTIK USUS PASIEN POST OPERASI SECTIO CAESAREADIRSIA ANUGERAH MEDICAL CENTER KOTA METROLAMPUNG TAHUN 2022. Diploma thesis, Poltekkes Tanjungkarang.

GIRI, KOMANG TIARA KORIDEVANI (2022) PERBEDAAN WAKTU PELAKSANAAN MOBILISASI DINI TERHADAP WAKTU PULIH PERISTALTIK USUS PASIEN POST OPERASI SECTIO CAESAREADIRSIA ANUGERAH MEDICAL CENTER KOTA METROLAMPUNG TAHUN 2022. Diploma thesis, Poltekkes Tanjungkarang.

GUSMILASARI, GUSMILASARI (2021) ASUHAN KEPERAWATAN PERIOPERATIF PADA PASIEN BENIGNA PROSTAT HIPERPLASIA DENGAN TINDAKAN TURP (TRANSURETHRAL RESECTION OF THE PROSTATE) DI RUANG OPERASI RUMAH SAKIT YUKUM MEDICAL CENTER TAHUN 2021. Diploma thesis, Poltekkes Tanjungkarang.

GUSNIA, HANI (2023) ASUHAN KEPERAWATAN PASIEN DENGAN GANGGUAN TERMOREGULASI PADA KASUS OBSERVASI FEBRIS TERHADAP AN. A DI RUANG EDELWIS LANTAI 2 RSU HANDAYANI KOTABUMI LAMPUNG UTARA TANGGAL 03-05 APRIL 2023. Diploma thesis, Poltekkes Kemenkes Tanjungkarang.

GUSTIANA, ANNISA (2023) ASUHAN KEPERAWATAN GANGGUAN KEBUTUHAN KEAMANAN PROTEKSI THERMOGULASI PADA PASIEN DHF DAN KEJANG DEMAM RUANGAN ALAMANDA RSUD Dr. H. ABDUL MOELOEK BANDAR LAMPUNG TAHUN 2023. Diploma thesis, Poltekkes KemenkesTanjungkarang.

GUSTIANA SATRA, DEWI (2023) ASUHAN KEPERAWATAN PADA PASIEN ULKUS DIABETIKUM POST DEBRIDEMENT DENGAN MASALAH KEPERAWATAN GANGGUAN INTEGRITAS JARINGAN DI RS BHAYANGKARA POLDA LAMPUNG TAHUN 2023. Diploma thesis, Poltekkes Kemenkes Tanjungkarang.

Ginting, BR Daria and Santosa, Imam and Trigunarso, Sri Indra (2022) Pengaruh Suhu, Kelembaban Dan Kecepatan Angin Air Conditioner (AC) Terhadap Jumlah Angka Kuman Udara Ruangan. Diploma thesis, Poltekkes Tanjungkarang.

H

HAFIDH, nur tsya (2021) Asuhan keperawatan pasien terhadap Ny. C dengan Gangguan kebutuhan Oksigenisasi pada kasus anemia di ruang penyakit -dalam RSUD MASJEND HM RYACUDU KOTABUMILAMPUNG UTARA TANGGAL MARET. Diploma thesis, Poltekkes tanjungkarang.

HALIMAH, LAILA (2023) ASUHAN KEPERAWATAN GERONTIK DENGAN GANGGUAN KEBUTUHAN RASA NYAMAN PADA KASUS HIPERTENSI TERHADAP TN. E DI KOTA ALAM WILAYAH KERJA PUSKESMAS KOTABUMI II KABUPATEN LAMPUNG UTARA TANGGAL 31 OKTOBER-03 NOVEMBER 2022. Diploma thesis, Poltekkes Kemenkes Tanjungkarang.

HALIZAH, SINDI NUR (2023) ASUHAN KEPERAWATAN KELUARGA DENGAN GANGGUAN KEBUTUHAN NUTRISI PADA KASUS DIABETES MELITUS TERHADAP NY S DI DESA BANDAR PUTIH WILAYAH KERJA PUSKESMAS KOTABUMI II KECAMATAN KOTABUMI SELATAN KABUPATEN LAMPUNG UTARA TANGGAL 17-19 OKTOBER 2022. Diploma thesis, Poltekkes Kemenkes Tanjungkarang.

HAMAS UGI PRAYOGI, HAMAS UGI (2023) ASUHAN KEPERAWATAN PASIEN DENGAN GANGGUAN OKSIGENASI PADA KASUS BRONKITIS TERHADAP NY. N DI RUANG PARU RSD MAYJEND HM RYACUDU KOTABUMI LAMPUNG UTARA TANGGAL 24-26 OKTOBER 2022. Diploma thesis, Poltekkes Kemenkes Tanjungkarang.

HANDAYANI, DIKA ROYHANA (2021) KEJADIAN PEDICULOSIS CAPITIS DI PONDOK PESANTREN (STUDI PUSTAKA). Diploma thesis, Poltekkes Tanjungkarang.

HANDAYANI, GITA METAVIA (2023) ASUHAN KEPERAWATAN GANGGUAN RASA NYAMAN PADA PASIEN POST AMPUTASI ULKUS DIABETIKUM DENGAN INTERVENSI RELAKSASI NAFAS DALAM DI RUMAH SAKIT MARDI WALUYO KOTA METRO TAHUN 2023. Diploma thesis, Poltekkes Kemenkes Tanjungkarang.

HANDAYANI, GITA METAVIA (2022) PENGARUH TERAPI MUSIK INSTRUMENTAL DAN AROMA TERAPI LAVENDER TERHADAP KUALITAS TIDUR PADA PASIEN POST OPERASI DI RSUD Dr. H ABDUL MOELOEK TAHUN 2022. Diploma thesis, Poltekkes Tanjungkarang.

HANDAYANI, SITI MEGA MARSULI (2022) ASUHAN KEPERAWATAN GANGGUAN KEBUTUHAN AMAN NYAMAN: NYERI PADA PASIEN CHEPALGIA DI RUANG SYARAF RSUD AHMAD YANI KOTA METRO PROV. LAMPUNG TAHUN 2022. Diploma thesis, Poltekkes Tanjungkarang.

HANDAYANI, WURI (2023) IMPLEMENTASI EDUKASI PERAWATAN STOMA PADA PASIEN POST OPERATIF COLOSTOMY DI RSUD AHMAD YANI KOTA METRO TAHUN 2023. Diploma thesis, Poltekkes Kemenkes Tanjungkarang.

HANDAYANI, WURI (2022) PENGARUH TERAPI BERMAIN LEGO BLOCK PADA ANAK PRASEKOLAH TERHADAP PENURUNAN KECEMASAN HOSPITALISASI PRE OPERASI DI RSUD DR. H. ABDUL MOELOEK PROVINSI LAMPUNG. Diploma thesis, Poltekkes Tanjungkarang.

HANDAYANI NIM :, MONICA DEWI (2023) PENGARUH RELAKSASI NAPAS DALAM MENGGUNAKAN PIPE BLOWING BALL TERHADAP SKALA NYERI ANAK POST OPERASI DI RSUD DR. H. ABDUL MOELOEK PROVINSI LAMPUNG TAHUN 2023. Diploma thesis, Poltekkes KemenkesTanjungkarang.

HAPSARI, ANNISA RIZQIANI (2023) ASUHAN KEPERAWATAN GANGGUAN KEBUTUHAN MOBILISASI PADA PASIEN POST PARTUM SECTIO CAESAREA DENGAN HIPERTENSI DI RSUD Dr. H. ABDUL MOELOEK PROVINSI LAMPUNG TAHUN 2023. Diploma thesis, Poltekkes KemenkesTanjungkarang.

HARDIANSYAH, RAIHAN (2020) ASUHAN KEPERAWATAN PADA PASIEN SINUSITIS DENGAN TINDAKAN FUNCTIONAL ENDOSCOPIC SINUS SURGERY (FESS) DI RUANG OK RUMAH SAKIT A. DADI TJOKRODIPO BANDAR LAMPUNG TAHUN 2020. Diploma thesis, Poltekkes Tanjungkarang.

HARTATI, ELI (2021) ASUHAN KEPERAWATAN PERIOPERATIF PADA IBU INPARTU INDIKASI PREEKLAMPSIA BERAT DENGAN TINDAKAN SECTIO CAESAREA DI RUANG INSTALASI BEDAH SENTRAL RSUD DR. H. ABDUL MOELOEK PROVINSI LAMPUNG TAHUN 2021. Diploma thesis, Poltekkes Tanjungkarang.

HARTINI, YOSMALIA MERTY (2020) PENGARUH KOMBINASI TEKNIK RELAKSASI NAFAS DALAM DAN AROMATHERAPI LAVENDER TERHADAP PENURUNAN INTENSITAS NYERI PADA PASIEN SECTIO CAESAREA DI RUANG DELIMA RSUD DR. H. ABDUL MOELOEK PROVINSI LAMPUNG TAHUN 2020. Diploma thesis, Poltekkes Tanjungkarang.

HASAN, NURMA SARI (2021) ASUHAN KEPERAWATAN KELUARGA LANSIA DENGAN GANGGUAN KEBUTUHAN RASA NYAMAN NYERI AKUT PADA NY.E PENDERITA HIPERTENSI DI WILAYAH WAY HALIM BANDAR LAMPUNG TAHUN 2021. Diploma thesis, Poltekkes Tanjungkarang.

HASIBUAN, BELLA ARYANTO (2023) PENGARUH MOBILISASI TERHADAP PROSES PENYEMBUHAN LUKA PADA PASIEN POST SECTIO CAESAREA DI RSIA ANUGERAH MEDICAL CENTER KOTA METRO PROVINSI LAMPUNG TAHUN 2023. Diploma thesis, Poltekkes Kemenkes Tanjungkarang.

HASIBUAN, RAHMA SARI (2021) ASUHAN KEPERAWATAN GANGGUAN NYERI KRONIS PADA KELUARGA BAPAK S KHUSUSNYA IBU J DENGAN ASAM URAT MENINGKAT TAHAP LANSIA DI SUMBERREJO KEMILING BANDAR LAMPUNG TAHUN 2021. Diploma thesis, Poltekkes Tanjungkarang.

HASIBUAN, SHEFIIA NOVERA ACHDIWATI (2021) ASUHAN KEPERAWATAN GANGGUAN KEBUTUHAN AMAN NYAMAN NYERI PADA KELUARGA PASANGAN BARU IBU R DENGAN GASTRITIS KELUARGA BAPAK F DI SUKADANA TAHUN 2021. Diploma thesis, Poltekkes Tanjungkarang.

HASNAH, RANIAH DAFIRA (2023) IMPLEMENTASI PERAWATAN LUKA MOIST WOUND HEALING MENGGUNAKAN MINYAK ZAITUN PADA ASUHAN KEPERAWATAN INTEGRITAS JARINGAN PASIEN POST DEBRIDEMEN DIRUMAHSAKIT MARDIWALUYOTAHUN2023. Diploma thesis, Poltekkes Kemenkes Tanjungkarang.

HASNAH, RANIAH DAFIRA (2022) PENGARUH PEMBERIAN GUIDED IMAGERY TERHADAPPERUBAHAN NYERI IBU POST OPERASI SEKSIO SESAREA DI RUMAH SAKIT UMUM HANDAYANIKOTABUMI TAHUN 2022. Diploma thesis, Poltekkes Tanjungkarang.

HASYANAH, NUR (2022) ASUHAN KEPERAWATAN KELUARGA TERHADAPINDIVIDU NY. R DENGAN GANGGUAN MOBILITAS FISIK PADA KASUS STROKE DIWILAYAH KERJA PUSKESMAS KOTABUMI II KABUPATEN LAMPUNG UTARA TANGGAL 21-23 FEBRUARI 2022. Diploma thesis, Poltekkes Tanjungkarang.

HATI, KARISMA INDAH PERMATA (2022) ASUHAN KEPERAWATAN GANGGUAN KEBUTUHAN RASA AMAN DAN NYAMAN: NYERI PADA PASIEN POST HERNIOTOMI DI RUANG BEDAH RSUD dr. A. DADI TJOKRODIPO KOTA BANDAR LAMPUNG TAHUN 2022. Diploma thesis, Poltekkes Tanjungkarang.

HATINA, NADIA INTAN (2023) ASUHAN KEPERAWATAN PADA PASIEN POSTDEBRIDEMENT ULKUS DIABETIKUM DALAM MENGATASINYERIAKUT DENGAN INTERVENSI AROMATERAPI LAVENDER DIRSUDAHMADYANIMETRO LAMPUNG TAHUN2023. Diploma thesis, Poltekkes Kemenkes Tanjungkarang.

HATINA, NADIA INTAN (2023) HUBUNGAN PERSEPSI PASIEN TERHADAP LUKA DAN NYERI DENGAN PEMENUHAN KEBUTUHAN NUTRISI PADA PASIEN POST OPERASI DIGESTIF DI RSUD Dr. H. ABDUL MOELOEK PROVINSI LAMPUNG TAHUN 2022. Diploma thesis, Poltekkes KemenkesTanjungkarang.

HAYUSI, AVIP SEPTIA (2023) ASUHAN KEPERAWATAN PASIEN DENGAN GANGGUAN NUTRISI DAN CAIRAN PADA KASUS POST SECTIO CAESAREA DENGAN INDIKASI PLASENTA PREVIA TERHADAP NY. S DI RUANG KEBIDANAN LANTAI 2 RSU HANDAYANI KOTABUMI LAMPUNG UTARA TANGGAL 30 MARET-1 APRIL 2023. Diploma thesis, Poltekkes Kemenkes Tanjungkarang.

HENDRAWAN, KAYLA AUREL LASYA (2023) ASUHAN KEPERAWATAN JIWA DENGAN GANGGUAN PERSEPSI SENSORI HALUSINASI PENDENGARAN PADA KASUS SKIZOFRENIA PARANOID TERHADAP Tn.S DI RUANG KUTILANG RUMAH SAKIT JIWA DAERAH PROVINSI LAMPUNG TANGGAL 8-10 MARET 2022. Diploma thesis, Poltekkes Kemenkes Tanjungkarang.

HENDRAWAN, PERNANDO (2023) PENGARUH SHOLAWAT NABI TIBBIL QULUB TERHADA PENURUNAN TINGKAT KECEMASAN PASIEN PRE OPERASI DI RSUD JEND AHMAD YANI METRO PROVINSI LAMPUNG TAHUN 2023. Diploma thesis, Poltekkes Kemenkes Tanjungkarang.

HERAWATI, WINDI PUTRI (2021) ASUHAN KEPERAWATAN GANGGUAN NYERI KRONIS PADA IBU W KELUARGA BAPAK S DENGAN HIPERTENSI DI DESA MANDAH KECAMATAN NATAR KABUPATEN LAMPUNG SELATAN TAHUN 2021. Diploma thesis, Poltekkes Tanjungkarang.

HERDANI, EZRA (2022) ASUHAN KEPERAWATAN GANGGUAN KEBUTUHAN OKSIGENASI PADA PASIEN GUILLAIN BARRE SYNDROME DI RUANG ICU RSUD JENDERAL AHMAD YANI KOTA METRO TAHUN 2022. Diploma thesis, Poltekkes Tanjungkarang.

HERLINA, HENI (2020) ASUHAN KEPERAWATAN PERIOPERATIF PADA PASIEN HERNIA EPIGASTRIK DENGAN TINDAKAN HERNIORAFI DI RUANG OPERASI RUMAH SAKIT AIRAN RAYA PROVINSI LAMPUNG. Diploma thesis, Poltekkes Tanjungkarang.

HERLISTINA, ERITA (2022) ASUHAN KEPERAWATAN GANGGUAN KEBUTUHAN OKSIGENASI PADA PASIEN TUBERKULOSIS PARU DI RUANG PARU RSUD JENDERAL AHMAD YANI KOTA METRO PROVINSI LAMPUNG TAHUN 2022. Diploma thesis, Poltekkes Tanjungkarang.

HERMAWAN, ROBBY (2020) PENGARUH KOMBINASI TEKNIK RELAKSASI AUTOGENIK DAN FINGER HOLD TERHADAP INTENSITAS NYERI PADA PASIEN POST OPERASI SECTIO CAESAREA DI RUMAH SAKIT UMUM DAERAH DR.H. ABDUL MOELOEK PROVINSI LAMPUNG TAHUN 2020. Diploma thesis, Poltekkes Tanjungkarang.

HERMAWATI, RIA (2023) ASUHAN KEPERAWATANGANGGUAN PENYAPIHAN VENTILATOR PADA PASIEN POST CRANIOTOMY DI RUANG ICU RSUD ABDUL MOELOEK PROVINSI LAMPUNG TAHUN 2023. Diploma thesis, Poltekkes Kemenkes Tanjungkarang.

HERMAWATI, RIA (2022) PENGARUH TERAPI MUSIK SUARA ALAM TERHADAP TINGKAT NYERI PADA PASIEN POST OPERASI ORIF DI RUANG BEDAH RSUD ABDUL MOELOEK PROVINSI LAMPUNG TAHUN 2022. Diploma thesis, Poltekkes Tanjungkarang.

HERTIKA, HERTIKA (2022) ASUHAN KEPERAWATAN GANGGUAN KEBUTUHAN RASA AMAN NYAMAN (NYERI) PADA PASIEN POST OPERASI HEMOROID DI RUMAH SAKIT BHAYANGKARA POLDA LAMPUNG TAHUN 2022. Diploma thesis, Poltekkes Tanjungkarang.

HERTIKA, HERTIKA (2022) ASUHAN KEPERAWATAN GANGGUAN KEBUTUHAN RASA AMAN NYAMAN (NYERI) PADA PASIEN POST OPERASI HEMOROID DI RUMAH SAKIT BHAYANGKARA POLDA LAMPUNG TAHUN 2022. Diploma thesis, Poltekkes Tanjungkarang.

HIDAYAH, NADILA (2021) ASUHAN KEPERAWATAN GANGGUAN KEBUTUHAN RASA NYAMAN NYERI PADA ANAK R KELUARGA BAPAK S DENGAN DISMENORE DI DESA GANTIWARNO KABUPATEN LAMPUNG TIMUR TAHUN 2021. Diploma thesis, Poltekkes Tanjungkarang.

HIDAYAT, BAGUS TAUFIQ (2023) ASUHAN KEPERAWATAN GANGGUAN TERMOREGULASI PADA PASIEN THYPOID DAN PASIEN POST OPERASI KISTA DUKTUS KOLEDOKUS DI RUANG ALAMANDA RSUD Dr. H. ABDOEL MOELOEK BANDAR LAMPUNG TAHUN 2023. Diploma thesis, Poltekkes KemenkesTanjungkarang.

HIDAYAT, FARID (2023) IMPLEMENTASI AROMATERAPI ESSENTIAL OILLAVENDER PADA PASIEN DENGAN MASALAH KEPERAWATAN NYERI AKUT POST OPERASIHERNIOTOMYDI RUANG BEDAH RS MARDI WALUYO KOTA METRO LAMPUNG TAHUN 2023. Diploma thesis, Poltekkes Kemenkes Tanjungkarang.

HIDAYAT, ROBI (2022) ASUHAN KEPERAWATAN PERIOPERATIF PADA PASIEN HIDROKEL DENGAN TINDAKAN HIDROKELEKTOMI DI RUMAH SAKIT MARDI WALUYO KOTA METRO TAHUN 2022. Diploma thesis, Poltekkes Tanjungkarang.

HIDAYAT, ROBI (2022) ASUHAN KEPERAWATAN PERIOPERATIF PADA PASIEN HIDROKEL DENGAN TINDAKAN HIDROKELEKTOMI DI RUMAH SAKIT MARDI WALUYO KOTA METRO TAHUN 2022. Diploma thesis, Poltekkes Tanjungkarang.

HIDAYAT, ROBI (2021) FAKTOR-FAKTOR YANG MEMPENGARUHI TINGKAT KECEMASAN PADA PASIEN PRE OPERASI DI RUANG RAWAT INAP BEDAH RSUD JENDERAL AHMAD YANI KOTA METRO PROVINSI LAMPUNG TAHUN 2021. Diploma thesis, Poltekkes Tanjungkarang.

HIDAYATI, AMANAH (2021) ASUHAN KEPERAWATAN GANGGUAN KEBUTUHAN RASA NYAMAN PADA ANAK F KELUARGA BAPAK B DENGAN SCABIES DI KAMPUNG BAYUR RAJABASA JAYA BANDAR LAMPUNG TAHUN 2021. Diploma thesis, Poltekkes Tanjungkarang.

HIDAYATULLAH, SUTRI SARIF (2021) ASUHAN KEPERAWATAN : GANGGUAN PEMENUHAN KEBUTUHAN MOBILITAS FISIK PADA NY.M DI KELUARGA TN.S DENGAN GOUT ARTHRITIS DI DESA SUDIMORO KE. SEMAKA KAB. TANGGAMUS TAHUN 2021. Diploma thesis, Poltekkes Tanjungkarang.

HINDARTO, WAHYU (2020) ASUHAN KEPERAWATAN GANGGUAN PEMENUHAN KEBUTUHAN OKSIGENASI PADA PASIEN TUBERKULOSIS PARU DI RUANG ISOLASI RSUD PRINGSEWU TAHUN 2020. Diploma thesis, Poltekkes Tanjungkarang.

HISAN, ZIAN HAFIZUL (2023) ASUHAN KEPERAWATAN GANGGUAN KEBUTUHAN SIRKULASI DI RUANG PENYAKIT DALAM PADA PASIEN DENGAN ANEMIA DI RSUD DR. A. DADI TJOKRODIPO KOTA BANDAR LAMPUNG TAHUN 2023. Diploma thesis, Poltekkes KemenkesTanjungkarang.

HUDA, MISBAHUL (2016) Resistensi Bakteri Gram Negatif Terhadap Antibiotik Di UPTD Balai Laboratorium Kesehatan Lampung Tahun 2012-2014. Diploma thesis, Poltekkes Tanjungkarang.

HUSNA, AMALIA (2023) ASUHAN KEPERAWATAN GANGGUAN KEBUTUHAN NUTRISI PADA PASIEN DENGAN DIABETES MELITUS DI RUANG PENYAKIT DALAM RSUD Dr. A. DADI TJOKRODIPO KOTA BANDAR LAMPUNG TAHUN 2023. Diploma thesis, Poltekkes KemenkesTanjungkarang.

HUSNIA, SITI (2021) GAMBARAN KADAR HEMOGLOBIN PADA IBU HAMIL DI PUSKESMAS WAY JEPARA, LAMPUNG TIMUR TAHUN 2020. Diploma thesis, Poltekkes Tanjungkarang.

Hakiki, Ahmad (2022) ASUHAN KEPERAWATAN PASIEN DENGAN GANGGUAN OKSIGENASIPADA KASUS ANEMIA TERHADAP Ny. NDI RUANG PENYAKIT DALAM RSD MAYJEND HM RYACUDU KOTABUMI LAMPUNG UTARATANGGAL 11–13 NOVEMBER 2021. Diploma thesis, Poltekkes Tanjungkarang.

Halim, Abdul and Agustanti, Dwi (2016) Pengaruh “Booklet” dalam Meningkatkan Persepsi dan Sikap Keluarga untuk Mendukung Lansia Memanfaatkan Posyandu Lansia. Diploma thesis, Poltekkes Tanjungkarang.

Halim, Abdul and Agustanti, Dwi (2017) Pengaruh “Booklet” dalam Meningkatkan Persepsi dan Sikap Keluarga untuk Mendukung Lansia Memanfaatkan Posyandu Lansia. Diploma thesis, Poltekkes Tanjungkarang.

Halim, Abdul and Agustanti, Dwi (2017) Pengaruh “Booklet” dalam Meningkatkan Persepsi dan Sikap Keluarga untuk Mendukung Lansia Memanfaatkan Posyandu Lansia. Diploma thesis, Poltekkes Tanjungkarang.

Handayani, Dwi (2022) ASUHAN KEBIDANAN PADA BATITA DENGAN KETERLAMBATAN PERKEMBANGAN BICARA DI TPMB ARYATI SUMARLINDA, S.ST DESA MARGA ASRI TULANG BAWANG BARAT. Diploma thesis, Poltekkes Tanjungkarang.

Haryanti, Sindi (2022) ASUHAN KEPERAWATAN PASIEN DENGAN GANGGUAN RASA AMAN NYAMANPADA KASUS POST OPERASIAPENDIKTOMI TERHADAP AN.M DIRUANG EDELWEISRS HANDAYANI KOTABUMILAMPUNG UTARA TANGGAL 21-23FEBRUARI2022. Diploma thesis, Poltekkes Tanjungkarang.

Hazhiyah, Siti (2022) APLIKASI VIRGIN COCONUT OIL (VCO) TERHADAP LUKA PERINEUM DERAJAT II PADA NY.Y DI PMB MARTINI A.Md.Keb BANDAR LAMPUNG. Diploma thesis, Poltekkes Tanjungkarang.

Herliza, Herliza (2022) ASUHAN KEPERAWATAN ANAK DENGAN GANGGUAN KEBUTUHAN NUTRISI PADA KASUS STUNTING TERHADAP An.M DI WILAYAH KERJA PUSKESMAS KOTABUMI IILAMPUNG UTARA TANGGAL 09-11 MARET 2022. Diploma thesis, Poltekkes Tanjungkarang.

Hermansyah, Hermansyah and Mardiani, Mardiani and Prayudhy, Yushananta (2018) Nurses’ Work Stress Prevention in Indonesian Hospitals with Structural Equation Modeling Approach. Diploma thesis, Poltekkes Tanjungkarang.

Hidayati, fitria (2021) ASUHAN KEPERAWATAN PASIEN DENGAN GANGGUAN MOBILITAS FISIK PADA KASUS SECTIO CAESAREA TERHADAP Ny.S di RUANG KEBIDANAN RSUD MAYJEND HM RYACUDU KOTABUMI LAMPUNG UTARA TANGGAL 11-13 MARET 2021. Diploma thesis, Poltekkes tanjungkarang.

Huda, Misbahul and Safitri, Nadia Azzahro Rona and Marhamah, Marhamah (2017) Gambaran Penderita Tuberculosis Multi Drug Resisten (TB MDR) Di RSUD Dr. H. Abdul Moeloek Provinsi Lampung Januari-Desember 2015. Diploma thesis, Poltekkes Tanjungkarang.

Huda, Misbahul and Zuliana, Desi and Nurminha, Nurminha (2017) Gambaran Hasil Pemeriksaan HIV di RSUD. Dr. H. Abdul Moeloek Provinsi Lampung tahun 2015. Diploma thesis, Poltekkes Tanjungkarang.

hasibuan, mitha aulia (2021) ASUHAN KEPERAWATAN PASIEN DENGAN GANGGUAN OKSIGENISASI PADA KASUS PNEUMONIA TERHADAP AN. A DI PUSKESMAS II KOTABUMI LAMPUNG UTARA TANGGAL 22 - 24 MARET 2021. Diploma thesis, Poltekkes tanjungkarang.

I

I DINANTI, TARA PEBRI (2023) ASUHAN KEPERAWATAN GANGGUAN NYERI AKUT PADA PASIEN POST SECTIO CAESAREA DENGAN OLIGOHIDRAMNION DI RSUD Dr. H. ABDUL MOELOEK PROVINSI LAMPUNG TAHUN 2023. Diploma thesis, Poltekkes KemenkesTanjungkarang.

I TRIYONO, OLVA NUGRAHEM (2023) HUBUNGAN DUKUNGAN SOSIAL TERHADAP TERJADINYA POST PARTUM BLUES PADA PASIEN POST OPERASI SECTIO CAESAREA DI RSIA ANUGERAH MEDICAL CENTER KOTA METRO TAHUN 2023. Diploma thesis, Poltekkes KemenkesTanjungkarang.

ICHA OKTAVIANA, OKTAVIANA ICHA (2022) ASUHAN KEPERAWATAN KELUARGA DENGAN GANGGUAN RASANYAMAN PADA KASUS GASTRITIS TERHADAP INDIVIDU NY.S DI DESA MULANG MAYA KECAMATAN KOTABUMI SELATAN KABUPATEN LAMPUNG UTARA TANGGAL 21-25 FEBRUARI 2022. Diploma thesis, Poltekkes Tanjungkarang.

IHSANIAH, HANA IQOMATUL (2020) ASUHAN KEPERAWATAN PERIOPERATIF PADA KASUS NEFROLITIASIS DENGAN TINDAKAN NEFROLITOTOMI DI INSTALASI BEDAH SENTRAL RSUD JENDRAL AHMAD YANI METRO TAHUN 2020. Diploma thesis, Poltekkes Tanjungkarang.

IKAWATI, DESI (2020) ASUHAN KEPERAWATAN PERIOPERATIF PADA PASIEN FRAKTUR FEMUR DENGAN TINDAKAN OPEN REDUCTION INTERNA FIXATION (ORIF) DI RUANG OPERASI RSUD JEND. AHMAD YANI METRO TAHUN 2020. Diploma thesis, Poltekkes Tanjungkarang.

IKSAN, IKSAN (2021) ASUHAN KEPERAWATAN PERIOPERATIF PADA PASIEN APENDISITIS DENGAN TINDAKAN APENDIKTOMI DI RUANG OPERASI RUMAH SAKIT H.dr.BOB BAZAR KALIANDA LAMPUNGSELATAN TAHUN 2021. Diploma thesis, Poltekkes Tanjungkarang.

IMADUDIN, M.BAHRUN (2022) ASUHAN KEPERAWATAN PERIOPERATIF PASIEN MULTIPLE VULNUS PUNCTUM DI RUMAH SAKIT MARDI WALUYO, METRO. Diploma thesis, Poltekkes Tanjungkarang.

IMAN, SRI WAHYUNI (2023) ASUHAN KEPERAWATAN GANGGUAN KEBUTUHAN OKSIGENASI PADA PASIEN ASMA DI DESA SRIMULYO PEMANGGILAN NATAR LAMPUNG SELATAN TAHUN 2023. Diploma thesis, Poltekkes KemenkesTanjungkarang.

IMARA, NOVRANDA (2021) GAMBARAN KADAR HbA1C PADA PENDERITA DIABETES MELLITUS USIA PRODUKTIF DI RS MARDI WALUYO KOTA METRO TAHUN 2019-2020. Diploma thesis, Poltekkes Tanjungkarang.

INDRIYANA, MIA NISKA (2023) HUBUNGAN TINGKAT NYERI DENGAN PEMENUHAN ACTIVITY DAILY LIVING (ADL) PASIEN POST OPERASI DI RUANG RAWAT INAP BEDAH KUTILANG RSUD Dr. H. ABDUL MOELOEK PROVINSI LAMPUNG TAHUN 2023. Diploma thesis, Poltekkes Kemenkes Tanjungkarang.

INDRIYANI, AYU (2021) ASUHAN KEPERAWATAN GANGGUAN KEBUTUHAN AKTIVITAS PADA LANSIA Ny. M KELUARGA Tn.D DENGAN GOUT ARTHRITIS DI LABUHAN RATU BANDAR LAMPUNG TAHUN 2021. Diploma thesis, Poltekkes Tanjungkarang.

INDRIYANI, FIFIN (2023) ASUHAN KEPERAWATAN PASIEN DENGAN GANGGUAN PERSEPSI SENSORI: HALUSINASI PENDENGARAN PADA KASUS SKIZOFRENIA PARANOID TERHADAP Nn. R DI RUANG MELATI RUMAH SAKIT JIWA DAERAH PROVINSI LAMPUNG TANGGAL 07-09 MARET 2022. Diploma thesis, Poltekkes Kemenkes Tanjungkarang.

INDRIYANTI, DESMA (2022) ASUHAN KEPERAWATAN GANGGUAN KEBUTUHAN NYERI DAN KENYAMANAN PADA PASIEN (CKR) CEDERA KEPALA RINGAN DI RUANG SYARAF RSUD JENDERAL AHMAD YANI METRO PROVINSI LAMPUNG TAHUN 2022. Diploma thesis, Poltekkes Tanjungkarang.

INNAYAH, RISKA (2023) ASUHAN KEPERAWATAN GANGGUAN KEBUTUHAN OKSIGENASI PADA PASIEN PNEUMONIA DI RUMAH SAKIT BHAYANGKARA POLDA LAMPUNG TAHUN 2023. Diploma thesis, Poltekkes KemenkesTanjungkarang.

IRIYANTO, EKA (2022) ASUHAN KEPERAWATAN PERIOPERATIF PADA PASIEN PERITONITIS DENGAN TINDAKAN LAPARATOMI DI KAMAR OPERASI RUMAH SAKIT BHAYANGKARA BANDAR LAMPUNG TAHUN 2022. Diploma thesis, Poltekkes Tanjungkarang.

IRMAYANI, IRMAYANI (2022) ASUHAN KEPERAWATAN PASIEN DENGAN GANGGUAN KEBUTUHAN OKSIGENASI PADA KASUS EFUSI PLEURA TERHADAP TN. D DI IGD RSUD JENDRAL AHMAD YANI KOTA METRO TANGGAL 15 NOVEMBER 2021. Diploma thesis, Poltekkes Tanjungkarang.

IRMAYANI, IRMAYANI (2022) ASUHAN KEPERAWATAN PASIEN DENGAN GANGGUAN KEBUTUHAN OKSIGENASI PADA KASUS EFUSI PLEURA TERHADAP TN. D DIIGD RSUD JENDRAL AHMAD YANI KOTA METRO TANGGAL 15 NOVEMBER2021. Diploma thesis, Poltekkes Tanjungkarang.

ISMI, DIAN AYU NINGSIH (2023) PENGARUH AUTOGENIC RELAXATION DENGAN MEDIA AUDIOMUSIC INSTRUMENTAL TERHADAP SKALA NYERI PADA PASIEN POST SECTIO CAESAREA DI RSUD Dr. H. ABDUL MOELOEK PROVINSI LAMPUNG TAHUN 2023. Diploma thesis, Poltekkes KemenkesTanjungkarang.

ISMISSALAMAH, AMALIA AYU (2022) ASUHAN KEPERAWATAN PASIEN DENGAN GANGGUAN SIRKULASI PADA KASUS MENOMETRORAGIA TERHADAP Ny.T DI RUANG KEBIDANAN RSU HANDAYANI KOTABUMI LAMPUNG UTARA TANGGAL 28 FEBRUARI-02 MARET 2022. Diploma thesis, Poltekkes Tanjungkarang.

ISTIKOMAH, RANI (2023) ASUHAN KEPERAWATAN GERONTIK DENGAN GANGGUAN KEBUTUHAN NUTRISI PADA KASUS DIABETES MELITUS TIPE 2 TERHADAP Tn. K DI DESA MULANG MAYA KECAMATAN KOTABUMI SELATAN KABUPATEN LAMPUNG UTARA TANGGAL 16 – 18 MARET 2023. Diploma thesis, Poltekkes Kemenkes Tanjungkarang.

ISTIQOMAH, DHIA (2021) ASUHAN KEPERAWATAN GANGGUAN RASA NYAMAN:NYERI PADA KELUARGA PASANGAN BARU BAPAK S DENGAN DISFUNGSI SEKSUAL KHUSUSNYA IBU R DI DUSUN CITEREP DESA MERAK BATIN NATAR LAMPUNG SELATAN TAHUN 2021. Diploma thesis, Poltekkes Tanjungkarang.

J

JANAH, LENA MIFTAHUL (2021) PERBEDAAN KADAR HEMOGLOBIN SEBELUM DAN SESUDAH HEMODIALISA PADA PASIEN GAGAL GINJAL KRONIK (STUDI PUSTAKA). Diploma thesis, Poltekkes Tanjungkarang.

JANNAH, ASSIFA AZILIA IZATUL (2021) ASUHAN KEPERAWATAN PASIEN DENGAN GANGGUAN SIRKULASI PADA KASUS ANEMIA TERHADAP Ny. R DI RUANG FRESIA LANTAI 3 RSU HANDAYANI KOTABUMI LAMPUNG UTARA TANGGAL 11-13 MARET 2021. Diploma thesis, Poltekkes Tanjungkarang.

JAUHARI, ASSYFA LINARA (2023) ASUHAN KEPERAWATAN GANGGUAN KEBUTUHAN NYAMAN PADA PASIEN DISPEPSIA DIRUANG PENYAKIT DALAM NON INFEKSIUS RSUD DR. H. ABDUL MOELOEK PROVINSI LAMPUNG TAHUN 2023. Diploma thesis, Poltekkes KemenkesTanjungkarang.

JAUHARI, KEMALA (2020) ASUHAN KEPERAWATAN GANGGUAN HARGA DIRI RENDAH PADA ANAK DI SDN 1 HAJIMENA KECAMATAN NATAR KABUPATEN LAMPUNG SELATAN. Diploma thesis, Poltekkes Tanjungkarang.

JAYA, ALDY ANDRYAN INDRA (2020) ASUHAN KEPERAWATAN GANGGUAN KEBUTUHAN KOMUNIKASI PADA LANSIA DENGANPENURUNAN PENDENGARAN DI WILAYAH KERJA UPTD PSLU TRESNA WERDHA NATAR LAMPUNG SELATAN TAHUN 2020. Diploma thesis, Poltekkes Tanjungkarang.

JAYA, ALDY ANDRYAN INDRA (2020) ASUHAN KEPERAWATAN GANGGUAN KEBUTUHAN KOMUNIKASI PADA LANSIA DENGANPENURUNAN PENDENGARAN DI WILAYAH KERJA UPTD PSLU TRESNA WERDHA NATAR LAMPUNG SELATAN TAHUN 2020. Diploma thesis, Poltekkes Tanjungkarang.

JAYA, ALDY ANDRYAN INDRA (2023) ASUHAN KEPERAWATAN NYERI AKUT DENGAN TINDAKANGENGGAMJARIPADAPASIENAPPENDIKTOMI DIRUMAH SAKIT BHAYANGKARABANDARLAMPUNG TAHUN2023. Diploma thesis, Poltekkes Kemenkes Tanjungkarang.

JAYA, SONI ARIFAN (2023) PERBEDAANEYEMASK DAN EARPLUGSTERHADAP KUALITASTIDUR PADA PASIEN POST OPERASI DI RSUD JEND. AHMAD YANI METRO TAHUN 2023. Diploma thesis, Poltekkes Kemenkes Tanjungkarang.

JAYA, YUDHI ATNA (2023) ASUHAN KEPERAWATAN PASIEN DENGAN GANGGUAN RASA AMAN NYAMAN PADA KASUS POST OPERASI APENDISITIS TERHADAP An.R DI RUANG EDELWEIS RSU HANDAYANI KOTABUMI LAMPUNG UTARA TANGGAL 22-24 MARET 2023. Diploma thesis, Poltekkes Kemenkes Tanjungkarang.

JAYANTI, PUTRI MEY (2020) ASUHAN KEPERAWATAN PASIEN DENGAN GANGGUAN RASA NYAMAN PADA KASUS POST SECTIO CAESARAE TERHADAP Ny. N DI RUANG KEBIDANAN RSD MAYJEND HM RYACUDU KOTABUMI LAMPUNG UTARA TANGGAL 01-06 APRIL 2019. Diploma thesis, Poltekkes Tanjungkarang.

JAYSENDIRA, DAYU (2023) ASUHAN KEPERAWATAN POLA NAPAS TIDAK EFEKTIF DENGAN INTERVENSI BLOWING BALLOONS PADA PASIEN EFUSI PLEURA DENGAN WSD DI RSUD DR. H. ABDUL MOELOEK PROVINSI LAMPUNG TAHUN 2023. Diploma thesis, Poltekkes Kemenkes Tanjungkarang.

JESICA, VUNKY YESSY (2023) ASUHAN KEPERAWATAN GANGGUAN KEBUTUHAN NYERI DAN KENYAMANAN PADA PASIEN POST OP SOFT TISUE TUMOR DI RUANG BEDAH RUMAH SAKIT Dr. A. DADI TJOKRODIPO TAHUN 2023. Diploma thesis, Poltekkes KemenkesTanjungkarang.

JUARIAH, SITI (2022) HUBUNGAN EFIKASI DIRI TERHADAP KEPATUHAN PASIEN KANKER PAYUDARA DALAM MENJALANI KEMOTERAPI DI RSUD Dr.H.ABDUL MOELOEK PROVINSI LAMPUNG TAHUN 2022. Diploma thesis, Poltekkes Tanjungkarang.

JUARIAH, SITI (2023) STUDI KASUS NYERI AKUT PADA PASIEN POST OPERASI VARIKOKEL DI RUMAH SAKIT BHAYANGKARA BANDAR LAMPUNG TAHUN 2023. Diploma thesis, Poltekkes Kemenkes Tanjungkarang.

JULITA, CINDY RIZKA (2021) ASUHAN KEPERAWATAN GANGGUAN KEBUTUHAN NYERIPADA IBU S KELUARGABAPAK S DENGAN GOUT ARTHRITIS DIDESA WAYLUNIKKECAMATANABUNG SELATAN KABUPATENLAMPUNG UTARA TAHUN 2021. Diploma thesis, Poltekkes Tanjungkarang.

JUMIATI, DWI FITRI (2020) ASUHAN KEPERAWATAN GANGGUAN KEBUTUHAN OKSIGENASI PADA PASIEN TUBERKULOSIS PARU DI RUANG MELATI RSUD Dr. H. ABDUL MOELOEK PROVINSI LAMPUNG TAHUN 2020. Diploma thesis, Poltekkes Tanjungkarang.

JUNAIDI, JUNAIDI (2021) ASUHAN KEPERAWATAN PERIOPERATIF PADA PASIEN DIABETES MELITUS DENGAN TINDAKAN DEBRIDEMEN DI RUANG OPERASI RSUD.dr.H.BOB BAZAR.SKM KALIANDA TAHUN 2021. Diploma thesis, Poltekkes Tanjungkarang.

Jannati, Ratu Nur Baiti (2022) EFEKTIVITAS PEMBERIAN MINYAK ZAITUN TERHADAP RUAM POPOK PADA BALITA DI PMB CHATARINA TARAHAN LAMPUNG SELATAN. Diploma thesis, Poltekkes Tanjungkarang.

Jayanti, Laras Dwi (2023) ASUHAN KEPERAWATAN GANGGUAN KEBUTUHAN AKTIVITAS PADA PASIEN DENGAN STROKE HEMORAGIK DAN EPILEPSI DI RUANG BOUGENVIL RSUD. Dr. H. ABDUL MOELOEK PROVINSI LAMPUNG TAHUN 2023. Diploma thesis, Poltekkes KemenkesTanjungkarang.

Jihan Afifah, Afifah Jihan (2022) ASUHAN KEPERAWATAN ANAK DENGAN GANGGUAN KEBUTUHANOKSIGENASI PADA KASUS ASMA BRONKIAL TERHADAP An. S DI DESA MULANG MAYA KOTABUMI LAMPUNG UTARA TANGGAL 07-09 MARET 2022. Diploma thesis, Poltekkes Tanjungkarang.

Juliana, Vina (2022) ASUHAN KEPERAWATAN PASIEN DENGAN GANGGUAN RASA AMAN NYAMAN PADA KASUS POST OPERASI TUMOR MAMAE TERHADAP Ny. C DI RUANG FREESIA RUMAH SAKIT UMUM HANDAYANI KOTABUMI LAMPUNG UTARA TANGGAL15 – 17 MARET 2022. Diploma thesis, Poltekkes Tanjungkarang.

K

KALSUM, NABILA UMI (2022) ASUHAN KEPERAWATAN PERIOPERATIF PADA PASIEN FIBROADENOMA MAMMAE DENGAN TINDAKAN EKSISI DI RUMAH SAKIT MARDI WALUYO METRO TAHUN 2022. Diploma thesis, Poltekkes Tanjungkarang.

KALSUM, NABILA UMI (2021) HUBUNGAN TINGKAT PENGETAHUAN PERAWAT DENGAN UPAYA PENERAPAN KESELAMATAN PASIEN DI INSTALASI BEDAH SENTRAL RSUD JENDERAL AHMAD YANI METRO PROVINSI LAMPUNG TAHUN 2021. Diploma thesis, Poltekkes Tanjungkarang.

KAMELIA, NURUL (2020) ASUHAN KEPERAWATAN GANGGUAN KEBUTUHAN RASA NYAMAN NYERI PADA KLIEN GOUT ARTHRITIS DI UPTD PSLU TRESNA WERDHA NATAR PROVINSI LAMPUNG. Diploma thesis, Poltekkes Tanjungkarang.

KARTIKASARI, RAHMA (2022) ASUHAN KEPERAWATAN TERHADAPNy. S DENGAN GANGGUAN MOBILITAS FISIK PADA KASUS POST SECTIO CAESAREADI RUANG KEBIDANAN RSU HANDAYANI KOTABUMI LAMPUNG UTARATANGGAL 21-23 FEBRUARI 2022. Diploma thesis, Poltekkes Tanjungkarang.

KARTINI, WAYAN INTAN (2023) ASUHAN KEPERAWATAN GANGGUAN KEBUTUHAN AKTIVITAS PADA PASIEN SECTIO CAESAREA DENGAN PREEKLAMSI BERAT DI RSUD Dr. H. ABDUL MOELOEK PROVINSI LAMPUNG TAHUN 2023. Diploma thesis, Poltekkes KemenkesTanjungkarang.

KHANSA, CAHYA AULIA (2023) ASUHAN KEPERAWATAN KELUARGA DENGAN GANGGUAN RASA AMAN NYAMAN PADA KASUS RHEUMATOID ARTHRITIS TERHADAP NY. Z DI DESA KOTA ALAM WILAYAH KERJA PUSKESMAS KOTABUMI II LAMPUNG UTARA TANGGAL 7-9 NOVEMBER 2022. Diploma thesis, Poltekkes Kemenkes Tanjungkarang.

KHANTI, PARAMITA ESTI (2023) GAMBARAN KEPUASAN PASIEN TERHADAP PELAYANAN KESEHATAN GIGI DAN MULUT DI PUSKESMAS PUNGGUR TAHUN 2023. Diploma thesis, Poltekkes Kemenkes Tanjungkarang.

KHARISMA, CYNTHIA FEBRI (2020) ASUHAN KEPERAWATAN PERIOPERATIF PASIEN DENGAN DIAGNOSA HERNIA SCROTALIS DENGAN TINDAKAN HERNIOTOMY HERNIORAPHY DI RUANG OPERASI RSUD AHMAD YANI METRO 2020. Diploma thesis, Poltekkes Tanjungkarang.

KHARISMAGANDES ZAHRA KHARISMA NIM. 1914301048, GANDES ZAHRA (2023) FAKTOR-FAKTOR YANG BERHUBUNGAN DENGAN WAKTU PULIH SADAR PASIEN POST OPERASI DENGAN GENERAL ANESTESI DI INSTALASI BEDAH SENTRAL RSUD Dr. H. ABDUL MOELOEK PROVINSI LAMPUNG TAHUN 2023. Diploma thesis, Poltekkes KemenkesTanjungkarang.

KHOIRIYAH, KHOIRIYAH (2021) ASUHAN KEPERAWATAN PERIOPERATIF PADA PASIEN BENIGNA PROSTAT HIPERPLASIA (BPH)DENGANTINDAKAN PROSTATEKTOMI DI RUANG OPERASI RUMAH SAKIT UMUM DAERAH AHMAD YANI METRO TAHUN 2021. Diploma thesis, Poltekkes Tanjungkarang.

KHOIRUNNISA, ZAQIA (2021) ASUHAN KEPERAWATAN GANGGUAN KEBUTUHAN OKSIGENASI PADA ANAK Z KELUARGA BAPAK N DENGAN INFEKSI SALURAN PERNAPASAN AKUT DI DESA UTAMA JAYA KECAMATAN SEPUTIH MATARAM KABUPATEN LAMPUNG TENGAH TAHUN 2021. Diploma thesis, Poltekkes Tanjungkarang.

KHOLIFAH, EVAIRUL (2023) ASUHAN KEPERAWATAN KELUARGA DENGAN GANGGUAN RASA NYAMAN PADA KASUS GOUT ARTHRITIS TERHADAP NY. K DI WILAYAH KERJA PUSKESMAS KOTABUMI II LAMPUNG UTARA TANGGAL 31 OKTOBER - 4 NOVEMBER 2022. Diploma thesis, Poltekkes Kemenkes Tanjungkarang.

KHOLIJAH, DESTI ANGGRAINI (2020) ASUHAN KEPERAWATAN GANGGUAN KEBUTUHAN OKSIGEN PADA PASIEN DENGAN TUBERCULOSIS DI RUANG PARU RSUD JENDRAL AHMAD YANI KOTA METRO PROVINSI LAMPUNG TAHUN 2020. Diploma thesis, Poltekkes Tanjungkarang.

KHOTIMAH, FIRDHA KHUSNUL (2020) ASUHAN KEPERAWATAN GANGGUAN KEBUTUHAN CAIRAN DAN ELEKTROLIT DENGAN MASALAH HIPOVOLEMIA PADA ANAK DENGAN DENGUE HAEMORAGIC FEVER (DHF) DI RUANG ANAK RSUD JENDRAL AHMAD YANI METRO PROVINSI LAMPUNG TAHUN 2020. Diploma thesis, Poltekkes Tanjungkarang.

KORINA, YUNITA (2023) ASUHANKEPERAWATANPADAPASIENPOSTSCDENGANMASALAHKEPERAWATANNYERIAKUTDIRUMAH SAKITBHAYANGKARA PROVINSI LAMPUNGTAHUN2023. Diploma thesis, Poltekkes Kemenkes Tanjungkarang.

KORINA, YUNITA (2022) PENGARUH TERAPI MUSIK KLASIK BEETHOUVEN TERHADAP KECEMASAN PASIEN POST OPERASI CA MAMAE DI RSUD DR. H. ABDUL MOELOEK PROVINSI LAMPUNG TAHUN 2022. Diploma thesis, Poltekkes Tanjungkarang.

KRISDAYANTI, SILVIA (2021) PENGARUH TERAPI RELAKSASI GUIDED IMAGERY TERHADAP NYERI PASIEN POST OPERASI PADA ANAK USIA SEKOLAH DI RSUD DR. H. ABDUL MOELOEK PROVINSI LAMPUNG TAHUN 2020. Diploma thesis, Poltekkes Tanjungkarang.

KRISDAYANTI, SILVIA (2020) PENGARUH TERAPI RELAKSASI GUIDED IMAGERY TERHADAP NYERI PASIEN POST OPERASI PADA ANAK USIA SEKOLAH DI RSUD DR. H. ABDUL MOELOEK PROVINSI LAMPUNG TAHUN 2020. Diploma thesis, Poltekkes Tanjungkarang.

KUMALADEWI, VERRY (2022) ASUHAN KEPERAWATAN GANGGUAN PEMENUHAN KEBUTUHAN AKTIVITAS DAN ISTIRAHAT PADA PASIEN PASCAOPERASI APENDISITIS DI RUANG BEDAH (E4) RSUD. dr. A. DADI TJOKRODIPO PROVINSI LAMPUNG TAHUN 2022. Diploma thesis, Poltekkes Tanjungkarang.

KURNIATI, DENI (2021) ASUHAN KEPERAWATAN GANGGUAN PEMENUHAN KEBUTUHAN NUTRISI PADA KELUARGA BAPAK D KHUSUSNYA IBU.Y PADA TAHAP CHILD BEARING DENGAN HIPEREMESIS GRAVIDARUM DI DESA WAY JAMBU KECAMATAN PESISIR SELATAN TAHUN 2021. Diploma thesis, Poltekkes Tanjungkarang.

KURNIATI, TRIEYA CLARA (2023) ASUHAN KEPERAWATAN PASIEN DENGAN GANGGUAN MOBILITAS FISIK PADA KASUS POST OPERASI SECTIO CAESAREA TERHADAP NY.B DI RUANG KEBIDANAN RSU HANDAYANI KOTABUMI LAMPUNG UTARA TANGGAL 20-22 MARET 2023. Diploma thesis, Poltekkes Kemenkes Tanjungkarang.

KURNIAWAN, DADI (2020) ASUHAN KEPERAWATAN GANGGUAN PEMENUHAN KEBUTUHAN BELAJAR (DEFISIT PENGETAHUAN) PADA PASIEN TUBERCULOSIS DI RUANG MELATI RSUD Dr. H. ABDUL MOELOEK PROVINSI LAMPUNG TAHUN 2020. Diploma thesis, Poltekkes Tanjungkarang.

KURNIAWAN, DENI (2020) ASUHAN KEPERAWATAN PERIOPERATIF PADA PASIEN FRAKTUR PHALANK DIGITI III PEDIS SINISTRA DENGAN TINDAKAN OPEN REDUCTION INTERNAL FIXATION DIRUANG OK RSUD Dr. A. DADI TJOKRODIPO TAHUN 2019. Diploma thesis, Poltekkes Tanjungkarang.

KURNIAWATI, DEWI (2021) ASUHAN KEPERAWATAN PERIOPERATIF PASIEN DENGANDIAGNOSA FISTULA UMBILIKAL DENGAN TINDAKAN OPERASILAPARATOMI DI RUMAH SAKIT BHAYANGKARABANDAR LAMPUNG TAHUN 2021. Diploma thesis, Poltekkes Tanjungkarang.

KURNIAWATI, DEWI (2020) HUBUNGAN LAMANYA OPERASI TERHADAP KEJADIAN HIPOTERMI PASCA GENERAL ANESTESI DI RUANG PEMULIHAN INSTALASI BEDAH SENTRAL RSUD Dr.H.ABDUL MOELOEK PROVINSI LAMPUNG TAHUN 2020. Diploma thesis, Poltekkes Tanjungkarang.

KUSWANTORO, DIAN (2020) ASUHAN KEPERAWATAN GANGGUAN RASA NYAMAN NYERI PADA KLIEN RHEUMATOID ARTRHITIS DI UPTD PSLU TRESNA WERDHA NATAR LAMPUNG SELATAN TAHUN 2020. Diploma thesis, Poltekkes Tanjungkarang.

Kartika, Kartika (2022) ASUHAN KEPERAWATAN PASIEN DENGAN GANGGUAN NUTRISI DAN CAIRAN PADA KASUS DIABETES MELITUS TERHADAP NY. E DI RUANG FREESIA LANTAI 3 RSU HANDAYANI KOTABUMI LAMPUNG UTARA, TANGGAL 14-16 MARET 2022. Diploma thesis, Poltekkes Tanjungkarang.

Kencana, Aji Surya (2021) PENATALAKSANAAN ASUHAN GIZI TERSTANDAR PADA PASIEN GAGAL GINJAL KRONIS DENGAN DIABETES MELITUS TIPE 2 DI RSUD KABUPATEN PESAWARAN TAHUN 2021. Diploma thesis, Poltekkes Tanjungkarang.

Khoironi, Yurida (2021) ASUPAN ZAT GIZI DAN STATUS GIZI PENDERITA THALASSEMIA (Studi Literature). Diploma thesis, Poltekkes Tanjungkarang.

Kurniawan, Adi (2023) Asuhan Keperawatan Anak Dengan Gangguan Termogulasi Pada Kasus Kejang Demam Terhadap An.M di RSU Handayani Kotabumi Kabupaten Lampung Utara Tanggal 03-05 April 2023. Diploma thesis, Poltekkes Kemenkes Tanjungkarang.

Kurniawan, Ardi (2021) ASUHAN KEPERAWATAN GAWAT DARURAT GANGGUAN NUTRISI PADA KASUS HIPOGLIKEMIA TERHADAP Ny. N DI RUANG IGD RSUD JEND AHMAD YANI KOTA METRO TANGGAL 29 MARET 2021. Diploma thesis, Poltekkes tanjungkarang.

L

LAKSONO, RENANDA BAGUS (2020) ASUHAN KEPERAWATAN GANGGUAN KEBUTUHAN CAIRAN PADA PASIEN DENGAN CHRONIC KIDNEY DISEASE DI RUANG MURAI RSUD Dr. H. ABDUL MOELOEK PROVINSI LAMPUNG TAHUN 2020. Diploma thesis, Poltekkes Tanjungkarang.

LARASATI, GUSTI AYU (2021) ASUHAN KEPERAWATAN GANGGUAN PEMENUHAN KEBUTUHAN MOBILITAS FISIK PADA KELUARGA LANSIA BAPAK S DENGAN GOUTARTHRITIS DI DESA MARANG KEC. PESISIR SELATAN KAB. PESISIR BARAT TAHUN 2021. Diploma thesis, Poltekkes Tanjungkarang.

LESTAPUJI, NUR INDAH (2021) ASUHAN KEPERAWATAN GANGGUAN KEBUTUHAN AKTIVITAS: INTOLERANSI AKTIVITAS PADA IBU R KELUARGA BAPAK Y DENGAN HIPOTENSI DI DESA KOTA TENGAH KEC WAY SINDI PESISIR BARAT LAMPUNG TAHUN 2021. Diploma thesis, Poltekkes Tanjungkarang.

LESTARI, ALRI (2021) ASUHAN KEPERAWATAN PERIOPERATIF PADA PASIEN PLASENTA PREVIA DENGANTINDAKAN SECTIO CAESAREA DI RUANG OPERASI RSUD ALIMUDIN UMAR LAMPUNG BARAT TAHUN 2021. Diploma thesis, Poltekkes Tanjungkarang.

LESTARI, ALRI (2020) EFEKTIFITAS MOBILISASI DINI DAN ROM AKTIF TERHADAP WAKTU PENGEMBALIAN PERISTALRIK USUS PADA PASIEN PASCA OPERASI DENGAN GENERAL ANESTESI DI RUANG RAWAT INAP RSUD DR. H. ABDUL MOELOEK PROVINSI LAMPUNG TAHUN 2020. Diploma thesis, Poltekkes Tanjungkarang.

LESTARI, ANASTASYA CAHYA (2023) PENGARUH MOBILISASI DINI TERHADAP PERUBAHAN MEAN ARTERIAL PRESSURE PADA PASIEN POST OPERASI DENGAN GENERAL ANESTESI DI RSUD Dr. H. ABDUL MOELOEK PROVINSI LAMPUNG. Diploma thesis, Poltekkes KemenkesTanjungkarang.

LESTARI, DWI YUNIKA (2021) ASUHAN KEPERAWATAN GANGGUAN KEBUTUHAN OKSIGENASI : BERSIHAN JALAN NAFAS TIDAK EFEKIF PADA KELUARGA Bp. R KHUSUSNYA An. K DENGAN INFEKSI SALURAN PERNAFASAN AKUT DI DESA REJOMULYO KECAMATAN JATI AGUNG KABUPATEN LAMPUNG SELATAN TAHUN 2021. Diploma thesis, Poltekkes Tanjungkarang.

LESTARI, ENDANG AYU (2023) ASUHAN KEPERAWATAN GANGGUAN KEBUTUHAN PSIKOSOSIAL HALUSINASI PADA PASIEN SKIZOFRENIA DI RUANG NURI RUMAH SAKIT JIWA DAERAH PROVINSI LAMPUNG TAHUN 2023. Diploma thesis, Poltekkes Kemenkes Tanjungkarang.

LESTARI, FEBRIANA DIAH (2021) ASUHAN KEPERAWATAN PASIEN DENGAN GANGGUAN TERMOREGULASI PADA KASUS OBSERVASI FEBRIS TERHADAP An. G DI RUANG ANAK RSUD MAYJEND RYACUDU KOTABUMI LAMPUNG UTARA 8-10 MARET 2021. Diploma thesis, Poltekkes Tanjungkarang.

LESTARI, FITRI DWI (2022) ASUHAN KEPERAWATAN GANGGUAN KEBUTUHAN CAIRAN DAN ELEKTROLIT PADA PASIEN DENGUE HAEMORRHAGIC FEVER (DHF) DI RUANG KELAS 3 RS BHAYANGKARA PROVINSI LAMPUNG TAHUN 2022. Diploma thesis, Poltekkes Tanjungkarang.

LESTARI, INDAH (2020) ASUHAN KEPERAWATAN GANGGUANKEBUTUHAN PERSONAL HYGIENE PADA PASIEN STROKE NON HEMORAGIK DI RUANG SYARAF RSUD JEND. AHMAD YANI METRO PROVINSI LAMPUNG TAHUN 2020. Diploma thesis, Poltekkes Tanjungkarang.

LESTARI, MAYA (2023) ASUHAN KEPERAWATAN PASIEN DENGAN GANGGUAN TERMOREGULASI PADA KASUS DENGUE HAEMORAGIC FEVER (DHF) TERHADAP AN.A DI RUANG EDELWEIS LANTAI 2 RSU HANDAYANI KOTABUMI LAMPUNG UTARA TANGGAL 14-16 MARET 2023. Diploma thesis, Poltekkes Kemenkes Tanjungkarang.

LESTARI, MEIDIA SUCI (2023) ASUHAN KEPERAWATAN GANGGUAN NYERI AKUT DENGAN INTERVENSI AROMATHERAPI LAVENDER PADA POST KISTEKTOMI DI RSUD DR.H.ABDUL MOELOEKPROVINSI LAMPUNG TAHUN2023. Diploma thesis, Poltekkes Kemenkes Tanjungkarang.

LESTARI, NIA (2020) ASUHAN KEPERAWATAN GANGGUAN KEBUTUHAN AKTIVITAS FISIK PADA PASIEN DENGAN STROKE HEMORAGIK DI RUANG BOUGENVILE RSUD Dr.ABDUL MOELOEK PROVINSI LAMPUNG TAHUN 2020. Diploma thesis, Poltekkes Tanjungkarang.

LESTARI, PUTRI AYU (2023) ASUHAN KEPERAWATAN PASIEN DENGAN GANGGUAN NUTRISI PADA KASUS DIABETES MELITUS TIPE 2 TERHADAP Ny. S DIRUANG PENYAKIT DALAM B/SRIKANDI 3 RUMAH SAKIT UMUM DAERAH AHMAD YANI METRO TANGGAL 31 OKTOBER-02 NOVEMBER 2022. Diploma thesis, Poltekkes Kemenkes Tanjungkarang.

LESTARI, SARI DWI (2020) ASUHAN KEPERAWATANGANGGUAN KEBUTUHAN PSIKOSOSIAL: HARGA DIRI RENDAH PADA KLIEN SKIZOFRENIA DI RUMAH PENITIPAN PASIEN GANGGUAN JIWA AULIA RAHMA KOTA BANDAR LAMPUNG TAHUN 2020. Diploma thesis, Poltekkes Tanjungkarang.

LESTARI, SISSY (2022) ASUHAN KEPERAWATAN PERIOPERATIF PADA PASIEN KANKER PAYUDARA DENGAN TINDAKAN KLASIK RADIKAL MASTEKTOMI DI RSUD DR.H ABDUL MOELOEK PROVINSI LAMPUNG TAHUN 2022. Diploma thesis, Poltekkes Tanjungkarang.

LESTARI, SUCI TRI (2021) ASUHAN KEPERAWATAN GANGGUAN KETIDAKSTABILAN KADAR GLUKOSA DARAH PADA LANSIA KELUARGA BAPAK R DI DESA PUTRA AJI 1, KEC.SUKADANA KAB. LAMPUNG TIMURPROV. LAMPUNGTAHUN 2021. Diploma thesis, Poltekkes Tanjungkarang.

LESTARI, VENI ALPIONITA (2021) ASUHAN KEPERAWATAN GANGGUAN PEMENUHAN KEBUTUHAN PENGETAHUAN Ny. S KELUARGA Tn. K DENGAN HIPERTENSI DI DESA RANTAU TEMIANG KABUPATEN WAY KANAN TAHUN 2021. Diploma thesis, Poltekkes Tanjungkarang.

LIANA, TRYSIA (2023) ASUHAN KEPERAWATAN KELUARGA DENGAN GANGGUAN AMAN NYAMAN PADA KASUS GOUT ARTHRITIS TERHADAP Tn.Z DI DESA MULANG MAYA KEC. KOTABUMI SELATAN KAB. LAMPUNG UTARA TANGGAL 31 OKTOBER-02 NOVEMBER 2022. Diploma thesis, Poltekkes Kemenkes Tanjungkarang.

LIESTI, EGI AMANDA (2023) ASUHAN KEPERAWATAN GANGGUAN KEBUTUHAN RASA NYAMAN PADA KLIEN HIPERTENSI DI DESA PEMANGGILAN KECAMATAN NATAR LAMPUNG SELATAN TAHUN 2023. Diploma thesis, Poltekkes KemenkesTanjungkarang.

LIMBONG, SEPTA RIOVALDO (2021) ASUHAN KEPERAWATAN PASIEN DENGAN GANGGUAN PEMENUHAN KEBUTUHAN OKSIGEN PADA STROKE HEMORAGIK TERHADAP Tn.H DI RUANG SARAF RSUD MAYJEND HM RYACUDU KOTABUMI LAMPUNG UTARA 11 – 13 MARET 2021. Diploma thesis, Poltekkes Tanjungkarang.

LIYANTI, REPI (2021) ASUHAN KEPERAWATAN DENGAN GANGGUAN KEBUTUHAN RASAAMAN NYAMAN PADA KASUS POST OP KISTA OVARIUM TERHADAP Ny. H DI RUANG KEBIDANAN RS HANDAYANI KOTABUMILAMPUNG UTARA TANGGAL 11-12 MARET 2021. Diploma thesis, Poltekkes Tanjungkarang.

LONA, DELVI TREESIA (2023) HUBUNGAN DUKUNGAN KELUARGA DENGAN TINGKAT KECEMASAN PADA PASIEN PRE OPERASI DI RUANG BEDAH RSUD Dr. H. ABDUL MOELOEK PROVINSI LAMPUNG TAHUN 2023. Diploma thesis, Poltekkes KemenkesTanjungkarang.

LUNINGGAR SARI, BEATRICE AYU (2021) ASUHAN KEPERAWATAN GAWAT DARURAT GANGGUAN KEBUTUHAN OKSIGENASI PADA TN.P DENGAN KASUS PNEUMONIA DI INSTALASI GAWAT DARURAT RSUD JEND AHMAD YANI METRO TANGGAL 02 APRIL 2021. Diploma thesis, Poltekkes Tanjungkarang.

LUSKINANTI, OLLIN (2023) ASUHAN KEPERAWATAN GANGGUAN KEBUTUHAN AMAN DAN NYAMAN (NYERI) PADA PASIEN DIABETES MELLITUS DI RUANG PENYAKIT DALAM NON INFEKSIUS RSUD Dr.H.ABDUL MOELOEK LAMPUNG TAHUN 2023. Diploma thesis, Poltekkes KemenkesTanjungkarang.

LUTFI, MIA MUSTOFA (2023) ASUHAN KEPERAWATAN DENGAN GANGGUAN OKSIGENASI PADA KASUS STROKE NON HEMORAGIC (SNH) TERHADAP NY. M DI RUANG SARAF RUMAH SAKIT UMUM DAERAH (RSUD) AHMAD YANI METRO TANGGAL 14-16 NOVEMBER 2022. Diploma thesis, Poltekkes Kemenkes Tanjungkarang.

Lestari, Fifi (2022) ASUHAN KEPERAWATAN GERONTIK TERHADAP NY.S PADA GANGGUAN RASA AMAN NYAMAN KASUS HIPERTENSI DI WILAYAH KERJA PUSKESMAS KOTABUMI II KABUPATEN LAMPUNG UTARA TANGGAL 21 FEBRUARI-05 MARET 2022. Diploma thesis, Poltekkes Tanjungkarang.

Lestari, Lidia (2022) ASUHAN KEPERAWATAN PASIENDENGAN GANGGUAN OKSIGENASI PADA KASUS STROKE NON HEMORAGIK TERHADAP TN. K DI RUANG FREESIA RSU HANDAYANI KOTABUMI LAMPUNG UTARA TANGGAL 11-13 NOVEMBER 2021. Diploma thesis, Poltekkes Tanjungkarang.

Lika, Iffina (2021) GAMBARAN PENGETAHUAN, ASUPAN DAN STATUS ANEMIA PADA REMAJA PUTRI DI PONDOK PESANTREN ASSALAFIYAH KECAMATAN MERBAU MATARAM KABUPATEN LAMPUNG SELATAN. Diploma thesis, Poltekkes Tanjungkarang.

Listiani, Novita (2023) ASUHAN KEPERAWATAN GERONTIK DENGAN GANGGUAN KEBUTUHAN RASA NYAMAN PADA KASUS GOUT ARTHRITIS TERHADAP NY. H DI DESA ALAM JAYA WILAYAH KERJA PUSKESMAS KOTABUMI II KABUPATEN LAMPUNG UTARA TANGGAL 11-14 OKTOBER 2022. Diploma thesis, Poltekkes Kemenkes Tanjungkarang.

Lorendra, Sella Rahmadani (2022) ASUHAN KEPERAWATAN PASIEN DENGAN GANGGUAN KEBUTUHAN OKSIGENASI PADA KASUS ASMA BRONCHIAL TERHADAP NY. Z DI RUANG PARU RSD MAYJEND HM RYACUDU KOTABUMI LAMPUNG UTARA PADA TANGGAL 01 - 03 DESEMBER 2021. Diploma thesis, Poltekkes Tanjungkarang.

Lutfiana Rahmatul Awalliyah, Awalliyah Lutfiana Rahmatul (2022) ASUHAN KEPERAWATAN DENGAN GANGGUAN OKSIGENASI PADA KASUS TUBERKULOSIS PARU TERHADAP NY. R DI RUANG PARU RSUD MAYJEND HM RYACUDU KOTABUMI LAMPUNG UTARA 28 FEBRUARI-04 MARET 2022. Diploma thesis, Poltekkes Tanjungkarang.

Luthfi Firmanda, Firmanda Luthfi (2022) ASUHAN KEPERAWATAN PASIEN DENGAN GANGGUAN OKSIGENASI PADA KASUS EFUSI PLEURA TERHADAP NY. H DI RUANG PARU RSDMAYJEND HM RYACUDU KOTABUMI LAMPUNG UTARA TANGGAL 21-23 FEBRUARI 2022. Diploma thesis, Poltekkes Tanjungkarang.

lestari, novia indah (2021) ASUHAN KEPERAWATAN PASIEN DENGAN GANGGUAN OKSIGENISASI PADA KASUS STROKE NON HEMORAGIK TERHADAP TN.A DI RUANG SYARAF RSUD MAYJEND HM RYACUDU KOTABUMI LAMPUNG UTARA TANGGAL 11–13 MARET 2021. Diploma thesis, Poltekkes tanjungkarang.

M

MAHARANI, DESI (2020) ASUHAN KEPERAWATAN GANGGUAN KEBUTUHAN AKTIVITAS PADA ANAK DENGAN THALASEMIA DI RUANG ANAK RSUD JENDRAL AHMAD YANI KOTA METRO PROVINSI LAMPUNG TAHUN 2020. Diploma thesis, Poltekkes Tanjungkarang.

MAHARANI, INDA (2023) ASUHAN KEPERAWATAN POST OPERASI LAPARATOMI PASIEN PERITONITISDALAM MENGATASI NYERI AKUT DENGAN INTERVENSI GUIDED IMAGERY DI RSUD DR. H. ABDUL MOELOEK PROVINSI LAMPUNG TAHUN2023. Diploma thesis, Poltekkes Kemenkes Tanjungkarang.

MAHARANI, INDA (2023) HUBUNGAN MOTIVASI TERHADAP MOBILISASI DINI PADA PASIEN POST OPERASI SEKSIO SESAREA DI RUMAH SAKIT UMUM HANDAYANI KOTABUMI TAHUN 2022. Diploma thesis, Poltekkes Kemenkes Tanjungkarang.

MAHARANI, OLSA (2023) ASUHAN KEPERAWATAN GANGGUAN KEBUTUHAN RASA NYAMAN PADA PASIEN DISPEPSIA DI RUMAH SAKIT BHAYANGKARA POLDA LAMPUNG TAHUN 2023. Diploma thesis, Poltekkes KemenkesTanjungkarang.

MAHARANI, PREPTI AYU (2021) ASUHAN KEPERAWATAN GANGGUAN KEBUTUHAN AKTIVITAS PADA ANAK E KELUARGA BAPAK E DENGAN ANEMIA DI DESA TANGKIT SERDANG KABUPATEN TANGGAMUS TAHUN 2021. Diploma thesis, Poltekkes Tanjungkarang.

MAHARANI, PUTRI (2022) ASUHAN KEPERAWATAN PERIOPERATIF PADA PASIEN VARIKOKEL DENGAN TINDAKAN VARIKOKELEKTOMI DI RSUD JENDERAL AHMAD YANI METRO TAHUN 2022. Diploma thesis, Poltekkes Tanjungkarang.

MAHARANI, PUTRI (2021) PENGARUH EDUKASI BOOKLET TERHADAP KESIAPAN IBU MENYUSUI POST OPERASI SECTIO CAESAREA DI RSU MUHAMMADIYAH METRO PROVINSI LAMPUNG TAHUN 2021. Diploma thesis, Poltekkes Tanjungkarang.

MAHARANI, S.Tr.Kep, PUTRI (2022) ASUHAN KEPERAWATAN PERIOPERATIF PADA PASIEN HERNIA INGUINALIS LATERALIS DENGAN TINDAKAN OPERASI HERNIORAPHY DI RUMAH SAKIT BHAYANGKARA POLDA LAMPUNG TAHUN 2022. Diploma thesis, Poltekkes Tanjungkarang.

MAHDALENA, MAHDALENA (2023) ASUHAN KEPERAWATAN GERONTIK DENGAN OKSIGENASI PADA KASUS ASMA TERHADAP TN. A DI DESA TANJUNG AMAN WILAYAH KERJA PUSKESMAS KOTABUMI II TANGGAL 14-16 MARET TAHUN 2023. Diploma thesis, Poltekkes Kemenkes Tanjungkarang.

MAHDI, MUHAMMAD FARKHAN NUR (2021) ASUHAN KEPERAWATAN DENGAN GANGGUAN CAIRANPADA KASUS GASTROENTERITIS AKUT(GEA)TERHADAPAn. A DI RUANG EDELWEIS RSU HANDAYANI KOTABUMILAMPUNG UTARATANGGAL 08-09 MARET 2021. Diploma thesis, Poltekkes Tanjungkarang.

MAHMUDDAH, MUHAMMAD KURNIAWAN (2021) ASUHAN KEPERAWATAN GANGGUAN KEBUTUHAN NYAMAN NYERI PADA TN. S KELUARGA TN. S DENGAN HIPERTENSI DI KELURAHAN WAY DADI BARU SUKARAME KOTA BANDAR LAMPUNG TAHUN 2021. Diploma thesis, Poltekkes Tanjungkarang.

MALINDA, SILWI YUSHA (2021) ASUHAN KEPERAWATAN KELUARGA GANGGUAN KEBUTUHAN BELAJAR PADA PASIEN INFERTILITAS DI WILAYAH NATAR LAMPUNG SELATAN TAHUN 2021. Diploma thesis, Poltekkes Tanjungkarang.

MANARA, MEGA MEILISA (2021) ASUHAN KEPERAWATAN PERIOPERATIF PADA PASIEN PERITONITIS ATAS INDIKASI APPENDIK PERFORASI DENGAN TINDAKAN LAPARATOMI EKSPLORASI DI RUANG OK RUMAH SAKIT AHMAD YANI KOTA METRO TAHUN 2021. Diploma thesis, Poltekkes Tanjungkarang.

MANARA, MEGA MEILISA (2020) PENGARUH TERAPI MUSIK SUARA ALAM TERHADAP PENINGKATAN TEKANAN DARAH DAN FREKUENSI DENYUT JANTUNG PASCA OPERASI DENGAN ANESTESI UMUM DI RSUD Dr. H. ABDUL MOELOEK PROVINSI LAMPUNG TAHUN 2020. Diploma thesis, Poltekkes Tanjungkarang.

MANIK, TANIA CLARISA BR (2023) ASUHAN KEPERAWATAN GERONTIK DENGAN GANGGUAN RASA AMAN NYAMAN PADA KASUS GASTRITIS TERHADAP TN. A DI DESA TANJUNG AMAN KABUPATEN LAMPUNG UTARA TANGGAL 14-16 MARET 2023. Diploma thesis, Poltekkes Kemenkes Tanjungkarang.

MANORA, CINDY KRISTINA (2022) ASUHAN KEPERAWATAN PASIEN DENGAN GANGGUAN KEBUTUHAN CAIRAN PADA KASUS DIARE TERHADAP AN. A DI WILAYAH KERJA PUSKESMAS KOTABUMI II TANGGAL 07-09 MARET 2022. Diploma thesis, Poltekkes Tanjungkarang.

MANULLANG, NIYA FESENSYA (2021) ASUHAN KEPERAWATAN GANGGUAN KEBUTUHAN NUTRISI DENGAN RISIKO BERAT BADAN LEBIH PADA KELUARGA BAPAK H KHUSUSNYA ANAK R DI WAY HUWI LAMPUNG SELATAN TAHUN 2021. Diploma thesis, Poltekkes Tanjungkarang.

MARCJOVA, DHEA (2021) ASUHAN KEPERAWATAN KELUARGA TN. M GANGGUAN KEBUTUHAN RASA NYERI KHUSUSNYA REMAJA AN. S DENGAN DERMATITIS DI TANJUNG BINTANG KABUPATEN LAMPUNG SELATAN TAHUN 2021. Diploma thesis, Poltekkes Tanjungkarang.

MARDALENA, MARDALENA (2021) ASUHAN KEPERAWATAN PERIOPERATIF PADA PASIEN PREEKLAMPSIA BERAT DENGAN TINDAKAN OPERASI SECTIO CAESARIA DI RUMAH SAKIT BOB BAZAR KALIANDA LAMPUNG SELATAN TAHUN 2021. Diploma thesis, Poltekkes Tanjungkarang.

MARDALENA, MARDALENA (2020) PENGARUH KOMBINASI TERAPI MUROTTAL AL-QUR’AN DAN HAND MASSAGE TERHADAP NYERI PADA PASIEN POST OPERASI DI RUANG RAWAT INAP BEDAH RSU HAJI KAMINO KABUPATEN WAY KANAN PROVINSI LAMPUNG. Diploma thesis, Poltekkes Tanjungkarang.

MARDALENA, MARDALENA (2021) PENGARUH KOMBINASI TERAPI MUROTTAL AL-QUR’AN DAN HAND MASSAGE TERHADAP NYERI PADA PASIEN POST OPERASI DI RUANG RAWAT INAP BEDAH RSU HAJI KAMINO KABUPATEN WAY KANAN PROVINSI LAMPUNG. Diploma thesis, Poltekkes Tanjungkarang.

MAREZA, SHANTI (2022) ASUHAN KEPERAWATAN GANGGUAN KEBUTUHAN AKTIVITAS PADA PASIEN STROKE NON HEMORAGIK DI RUMAH SAKIT BHAYANGKARA POLDA LAMPUNG TAHUN 2022. Diploma thesis, Poltekkes Tanjungkarang.

MARHAMAH, MARHAMAH (2021) ASUHAN KEPERAWATAN PERIOPERATIF PADA PASIEN ILEUS OBSTRUKTIF DENGAN TINDAKAN LAPARATOMI EKSPLORASI DI RUANG OPERASI RSUD JEND. AHMAD YANI METRO PROVINSI LAMPUNG TAHUN 2021. Diploma thesis, Poltekkes Tanjungkarang.

MARHAMAH, MARHAMAH (2020) PENGARUH PEMBERIAN TERAPI RELAKSASI BENSON TERHADAP PENURUNAN INTENSITAS NYERI PASIEN POST OPERASI DI RUANG RAWAT INAP BEDAH RSUD Dr. H. ABDUL MOELOEK PROVINSI LAMPUNG. Diploma thesis, Poltekkes Tanjungkarang.

MARHANDA, FIRLY (2023) ASUHAN KEPERAWATAN KEBUTUHAN MOBILITAS FISIK PADA KASUS STROKE NON HEMORAGIC TERHADAP Ny.H DI RUMAH SAKIT UMUM HANDAYANI PROVINSI LAMPUNG TANGGAL 20-22 NOVEMBER 2022. Diploma thesis, Poltekkes Kemenkes Tanjungkarang.

MARIAM, IRA (2022) ASUHANKEPERAWATANPERIOPERATIFPADAPASIENOSTEOARTRITIS DENGAN TINDAKAN TOTAL KNEEREPLACEMENT(TKR)DIRUMAHSAKIT RSUD DR. H. ABDOEL MOELOEK LAMPUNGTAHUN 2022. Diploma thesis, Poltekkes Kemenkes Tanjungkarang.

MARLINA, YANTI (2022) ASUHAN KEPERAWATAN KELUARGA DENGAN GANGGUAN AMAN NYAMAN PADA KASUS GOUT ARTHRITIS TERHADAP Tn. S DI DESA BANDAR PUTIH WILAYAH KERJA PUSKESMAS KOTABUMI II KABUPATEN LAMPUNG UTARA TANGGAL 21-23 FEBRUARI 2022. Diploma thesis, Poltekkes Tanjungkarang.

MARTALINA, MARTALINA (2022) ASUHAN KEPERAWATAN PASIEN DENGAN GANGGUAN SIRKULASI PADA KASUS ANEMIA TERHADAP TN. T DIRUANG FREESIA RSU HANDAYANI KOTABUMI LAMPUNG UTARA TANGGAL 16 – 18 MARET 2022. Diploma thesis, Poltekkes Tanjungkarang.

MASITOH, DWI DEWI (2021) PENGARUH AROMATERAPI CHAMOMILE DAN EFFLEURAGE MASSAGE TERHADAP PENURUNAN SKALA NYERI IBU POST OPERASI SECTIO CAESAREA DI RUMAH SAKIT TIPE C PROVINSI LAMPUNG TAHUN 2021. Diploma thesis, Poltekkes Tanjungkarang.

MAULA, AMREZA (2022) ASUHAN KEPERAWATAN PERIOPERATIF PADA PASIEN STRUMA NODUSA NON TOKSIK (SNNT) DENGAN TINDAKAN ISTHMOLOBECTOMY DI RUANG OPERASI RS BHAYANGKARA POLDA LAMPUNG TAHUN 2022. Diploma thesis, Poltekkes Tanjungkarang.

MAULIDINA, RIZKY (2022) ASUHAN KEPERAWATAN PERIOPERATIF PADA PASIEN STRUMA NODUSA NON TOKSIK (SNNT) DENGAN TINDAKAN ISTHMOLOBECTOMY DI RS MARDI WALUYO METRO TAHUN 2022. Diploma thesis, Poltekkes Tanjungkarang.

MAULINA, YUNIKA (2023) ASUHAN KEPERAWATAN PASIEN DENGAN GANGGUAN OKSIGENASI PADA KASUS PNEUMONIA TERHADAP An.R DI RUANG EDELWEIS RSU HANDAYANI KOTABUMI LAMPUNG UTARA TANGGAL 03 – 05 April 2023. Diploma thesis, Poltekkes Kemenkes Tanjungkarang.

MAYASARI, INTAN (2023) ASUHAN KEPERAWATAN NYERI AKUT PADA PASIEN POST OP MASTEKTOMI DENGAN INTERVENSI AROMATERAPI LAVENDER DI RUMAH SAKIT BHAYANGKARA POLDA LAMPUNG TAHUN 2023. Diploma thesis, Poltekkes Kemenkes Tanjungkarang.

MAYSARI, ELDA (2023) PENERAPAN TEKNIK RELAKSASI NAFAS DALAM DAN AROMATERAPI LAVENDER PADA PASIEN POST PROSTATEKTOMI DENGAN MASALAH NYERI AKUT DI RUMAH SAKIT MARDI WALUYO KOTA METRO TAHUN 2023. Diploma thesis, Poltekkes Kemenkes Tanjungkarang.

MAYSARI, ELDA (2022) PENGARUH TEKNIK RELAKSASI NAFAS DALAM DAN AROMATERAPI LAVENDER TERHADAP PENURUNAN TINGKAT NYERI PADAPASIENPOST OPERASI DI RSUD JENDERAL AHMAD YANI KOTA METRO PROVINSI LAMPUNG TAHUN 2022. Diploma thesis, Poltekkes Tanjungkarang.

MELANIA, LETI KRISTIA (2023) IMPLEMENTASI AROMATERAPI LAVENDER PADA PASIEN DENGAN MASALAH KEPERAWATAN NYERI AKUT POST OPERASI APENDIKTOMIDI RUMAH SAKIT MARDI WALUYO METROTAHUN 2023. Diploma thesis, Poltekkes Kemenkes Tanjungkarang.

MELANIA, LETI KRISTIA (2023) PENGARUH FOOT MASSAGE DAN INHALASI AROMATERAPI LAVENDER TERHADAP PENURUNAN TINGKAT NYERIIBU POST OPERASI SEKSIO SESAREA DI RUANG RAWAT INAP RSUD DR. H. ABDUL MOELOEK PROVINSI LAMPUNG TAHUN 2022. Diploma thesis, Poltekkes Kemenkes Tanjungkarang.

MELIANI, FENI (2023) HUBUNGAN USIA DAN FREKUENSI INDIKASI SC DENGAN LAMA RAWAT INAP PASIEN POST SECTIO CAESAREA DI RSIA RESTU BUNDA KOTA BANDAR LAMPUNG DAN RSUD Dr. H. ABDUL MOELOEK PROVINSI LAMPUNG TAHUN 2023. Diploma thesis, Poltekkes KemenkesTanjungkarang.

MELINDA, NENA (2023) ASUHAN KEPERAWATAN JIWA DENGAN GANGGUAN PEMENUHAN KEBUTUHAN PSIKOSOSIAL HALUSINASI PADA PASIEN SKIZOFRENIA DI RUANG NURI RUMAH SAKIT JIWA DAERAH PROVINSI LAMPUNG TAHUN 2023. Diploma thesis, Poltekkes KemenkesTanjungkarang.

MELINDA, UKHTINA EKA (2020) ASUHAN KEPERAWATAN GANGGUAN PEMENUHAN KEBUTUHAN BELAJAR PADA KELUARGA DENGAN PEMERIKSAAN PAYUDARA SENDIRI (SADARI) PADA REMAJA PUTRI DI WILAYAH KERJA PUSKESMAS NATAR LAMPUNG SELATAN TAHUN 2020. Diploma thesis, Poltekkes Tanjungkarang.

MELINIA, NI MADE (2022) PENGARUH KOMBINASI TEKNIK RELAKSASI BENSON DAN NATURAL SOUND TERHADAP INTENSITAS NYERI PASIEN POST OPERASI LAPARATOMI DI RSUD Dr. H. ABDUL MOELOEK PROVINSI LAMPUNG TAHUN 2022. Diploma thesis, Poltekkes Tanjungkarang.

MELINIA, NI MADE (2023) STUDI KASUS PADA PASIEN POST APENDIKTOMI DENGAN INTERVENSI INOVASI TEKNIK RELAKSASI GENGGAM JARI DI RUMAH SAKIT MARDI WALUYO KOTA METROTAHUN 2023. Diploma thesis, Poltekkes Kemenkes Tanjungkarang.

MELINIA, TARA (2022) ASUHAN KEPERAWATAN PERIOPERATIF PADA PASIEN ATRESIA ANI DENGAN TINDAKAN RESEKSI DAN ANASTOMOSIS DI RSUD Dr. H ABDUL MOELOEK PROVINSI LAMPUNG TAHUN 2022. Diploma thesis, Poltekkes Tanjungkarang.

MERDALIANA, MERDALIANA (2021) ASUHAN KEPERAWATAN GANGGUAN KEBUTUHAN RASA NYAMAN PADA REMAJA KHUSUSNYA ANAK Sn KELUARGA BAPAK S DENGAN DISMINORE DI KELURAHAN SUKAMARGA KECAMATAN BANGKUNAT KABUPATEN PESISIR BARAT PROVINSI LAMPUNG TAHUN 2021. Diploma thesis, Poltekkes Tanjungkarang.

MERISA, SITI (2023) ASUHAN KEPERAWATAN PASIEN DENGAN GANGGUAN OKSIGENASI PADA KASUS ASMA BRONKIAL TERHADAP Tn. S DI RUANG PARU RUMAH SAKIT DAERAH MAYJEND H.M RYACUDU KOTABUMI TANGGAL 14-16 NOVEMBER 2022. Diploma thesis, Poltekkes Kemenkes Tanjungkarang.

MILATI, MILATI (2020) ASUHAN KEPERAWATAN GANGGUAN KEBUTUHAN TERMOREGULASI DENGAN MASALAH HIPERTERMI PADA ANAK DEMAM THYPOID DI RUANG ANAK RSUD. JEND. AHMAD YANI METRO PROVINSI LAMPUNG TAHUN 2020. Diploma thesis, Poltekkes Tanjungkarang.

MILATI, WIDDATUL (2021) ASUHAN KEPERAWATAN GANGGUAN KEBUTUHAN KEAMANAN DAN PROTEKSI KERUSAKAN INTEGRITAS KULIT PADA ANAK USIA SEKOLAH AN. A KELUARGA BAPAK T DENGAN DERMATITIS ATOPIK DI DESA KALIBENING TALANGPADANG KABUPATEN TANGGAMUS TAHUN 2021. Diploma thesis, Poltekkes Tanjungkarang.

MIRANDA, AYU INDRY (2023) ASUHAN KEPERAWATAN GANGGUAN KEBUTUHAN RASA NYAMAN (NYERI) PADA PASIEN POST OP ABSES PEDIS DI RUMAH SAKIT TK IV 02.07.04 DEKENSYAH 02.04.03 LAMPUNG TAHUN 2023. Diploma thesis, Poltekkes KemenkesTanjungkarang.

MOELY, NUR TSALSABILLA (2022) ASUHAN KEPERAWATAN GANGGUAN KEBUTUHAN RASA NYAMAN (NYERI) PADA PASIEN POST OPERASI TUMOR COLLI SUBCLAVICULA SINISTRA DI RUMAH SAKIT BHAYANGKARA POLDA LAMPUNG TAHUN 2022. Diploma thesis, Poltekkes Tanjungkarang.

MUAWANAH, KHOLISATUL (2023) IMPLEMENTASI KOMPRES DINGIN PADAASUHAN KEPERAWATAN NYERI POSTOPERASI HEMOROID DI RUMAH SAKIT MARDI WALUYO KOTA METROTAHUN 2023. Diploma thesis, Poltekkes Kemenkes Tanjungkarang.

MUHAMMAD, AGISNI (2023) ASUHAN KEPERAWATAN GANGGUAN RASA AMAN NYAMAN PADA PASIEN PASCA OPERASI TONSILEKTOMI DI RS BHAYANGKARA POLDA LAMPUNG TAHUN 2023. Diploma thesis, Poltekkes KemenkesTanjungkarang.

MUHTAROM, DICKY WAHYU (2022) ASUHAN KEPERAWATAN GANGGUAN KEBUTUHAN OKSIGENASI PADA PASIEN STROKE NON HEMORAGIK DI RUANG ICU RSUD JENDERAL AHMAD YANI METRO TAHUN 2022. Diploma thesis, Poltekkes Tanjungkarang.

MUHTAROM, DICKY WAHYU (2022) ASUHAN KEPERAWATAN GANGGUAN KEBUTUHAN OKSIGENASI PADA PASIEN STROKE NON HEMORAGIK DI RUANG ICU RSUD JENDERAL AHMAD YANI METRO TAHUN 2022. Diploma thesis, Poltekkes Tanjungkarang.

MUKHLISIN, RANDI ARIASTA (2023) ASUHAN KEPERAWATAN PADA PASIEN POSTCRANIOTOMY DENGAN MASALAH KEPERAWATAN GANGGUAN PENYAPIHAN VENTILATOR DI RUANG ICU RSUD DR. H. ABDUL MOELOEK PROVINSI LAMPUNG. Diploma thesis, Poltekkes Kemenkes Tanjungkarang.

MUKHLISIN, RANDI ARIASTA (2023) PENGARUH ACUPRESSURE WRISTBAND DI TITIK NEIGUAN (P6) TERHADAP POST OPERATIVE NAUSEA VOMITING (PONV) PADA PASIEN BEDAH DI RSUD DR. H. ABDUL MOELOEK. Diploma thesis, Poltekkes KemenkesTanjungkarang.

MULYANI, NOVITA (2022) ASUHAN KEPERAWATAN GANGGUAN KEBUTUHAN SIRKULASI PADA PASIEN INDIOPATHIC TROMBOSITUPENIA PURPURA DI RUANG RPD A RSUD JEND.AHMAD YANI KOTA METRO PROVINSI LAMPUNG TAHUN 2022. Diploma thesis, Poltekkes Tanjungkarang.

MULYANI, SRI (2021) ASUHAN KEPERAWATAN GANGGUAN BERSIHAN JALAN NAFAS TIDAK EFEKTIF PADA ANAK SEKOLAH KELUARGA BAPAK E DENGAN ISPA KHUSUSNYA ANAK D DI DUSUN II KEBON BIBIT HAJIMENA KECAMATAN NATAR LAMPUNG SELATAN TAHUN 2021. Diploma thesis, Poltekkes Tanjungkarang.

MULYANI, SRI (2021) ASUHAN KEPERAWATAN GANGGUAN BERSIHAN JALAN NAFAS TIDAK EFEKTIF PADA ANAK SEKOLAH KELUARGA BAPAK E DENGAN ISPA KHUSUSNYA ANAK D DI DUSUN II KEBON BIBIT HAJIMENA KECAMATAN NATAR LAMPUNG SELATAN TAHUN 2021. Diploma thesis, Poltekkes Tanjungkarang.

MULYONO, MULYONO (2022) ASUHAN KEPERAWATAN PERIOPERATIF PADA PASIEN G2P1A0 43 MINGGU INDIKASI POST MATUR DENGAN TINDAKAN SEKSIO SESARIA DI RUMAH SAKIT BHAYANGKARA POLDA LAMPUNG TAHUN 2022. Diploma thesis, Poltekkes Tanjungkarang.

MUNANDAR, LEKAT ARIS (2021) ASUHAN KEPERAWATAN GERONTIK TERHADAP Tn. N DENGAN NYERI AKUT PADA KASUS POST OP BENIGNA PROSTAT HIPERLASIA DI DESA TANJUNG AMAN KEC KOTABUMI SELATAN KABUPATEN LAMPUNG UTARA TANGGAL 23 - 25 MARET 2021. Diploma thesis, Poltekkes Tanjungkarang.

MUNAZIR, RIZKI HANAFI (2023) PENERAPAN FISIOTERAPI DADA TERHADAP PENINGKATAN STATUS OKSIGENASI PADA ANAK DENGAN BRONKOPNEUMONIA DI RUANG E2 (ANAK) RSUD dr. A. DADI TJOKRODIPO KOTA BANDAR LAMPUNG TAHUN 2023. Diploma thesis, Poltekkes KemenkesTanjungkarang.

MUQTADIROH, ADDINATUL (2021) ASUHAN KEPERAWATAN PERIOPERATIF PADA PASIEN CA MAMMAE DENGAN TINDAKAN OPERASI MASTEKTOMI DI RUANG OPERASI RUMAH SAKIT BHAYANGKARA POLDA LAMPUNG TAHUN 2021. Diploma thesis, Poltekkes Tanjungkarang.

MUQTADIROH, ADDINATUL (2020) PERBEDAAN PERISTALTIK USUS SEBELUM DAN SESUDAH DILAKUKAN ROM AKTIF ASISTIF EKSTREMITAS BAWAH PADA PASIEN POST OPERASI DENGAN GENERAL ANESTHESI DI RSUD Dr. H. ABDUL MOELOEK PROVINSI LAMPUNG TAHUN 2020. Diploma thesis, Poltekkes Tanjungkarang.

MURNI, AWINDA NOVA SETIA (2022) ASUHAN KEPERAWATAN PERIOPERATIF PADA PASIEN TUMOR COLON DENGAN TINDAKAN HEMIKOLEKTOMI DI RSUD.Dr.H. ABDUL MOELOEK PROVINSI LAMPUNG TAHUN 2022. Diploma thesis, Poltekkes Tanjungkarang.

MURTADHO, DANELLA AMADEA (2023) PENERAPAN MOBILISASI DINI PADA PASIENPOST SECTIOCAESAREA DENGANMASALAH KEPERAWATAN NYERI AKUT DIRUMAH SAKIT BHAYANGKARA POLDA LAMPUNG TAHUN 2023. Diploma thesis, Poltekkes Kemenkes Tanjungkarang.

MURTADHO, DANELLA AMADEA (2022) PENGARUH PEMBERIAN AROMATERAPI CHAMOMILE INHALASI TERHADAP POST OPERATIVE NAUSEA AND VOMITING PADA PASIEN POST OPERASI DENGAN GENERAL ANESTESI DI RSUD DR. H. ABDUL MOELOEK PROVINSI LAMPUNG TAHUN 2022. Diploma thesis, Poltekkes Tanjungkarang.

MUSBA, RESTI WAFIQA (2022) ASUHAN KEPERAWATAN GANGGUAN KEBUTUHAN AMAN NYAMAN PADA PASIEN PRE OPERASI SINUSITIS DI RUANG MAWARRSU DKT BANDAR LAMPUNG PROVINSI LAMPUNG TAHUN 2022. Diploma thesis, Poltekkes Tanjungkarang.

MUSLIMAH P, TEHNIKITA AYU NUR (2020) ASUHAN KEPERAWATAN GANGGUAN KEBUTUHAN OKSIGENASI PADA PASIEN ASMA BRONKIAL DI RUANG MELATI RSUD Dr. H. ABDUL MOELOEK PROVINSI LAMPUNG TAHUN 2020. Diploma thesis, Poltekkes Tanjungkarang.

MUSYAFFA, M. ABDUH (2023) PERBEDAAN LAMA HARI RAWAT PASIEN SECTIO CAESAREA MENGGUNAKAN METODE ENHANCED RECOVERY AFTER CAESARIAN SURGERY (ERACS) DENGAN SECTIO CAESAREA KONVENSIONAL DI RUMAH SAKIT PROVINSI LAMPUNG TAHUN 2023. Diploma thesis, Poltekkes Kemenkes Tanjungkarang.

MUSYAFFA, M. ABDUH and MASITOH, DWI DEWI and ROSDIANTIKA, OKTA (2022) PERAWAT CEGAH STUNTING DENGAN TODDLER ACTIVITY AND PARENTS DAILY SCHEDULE (PERCENTINGAN TAAPIS). Diploma thesis, Poltekkes Tanjungkarang.

MUTHIA, ANANDA (2020) ASUHAN KEPERAWATAN GANGGUAN KEAMANAN DAN PROTEKSI PADA PASIEN DIABETES MELITUS DI RUANG MAWAR RSUD Dr. H. ABDUL MOELOEK PROVINSI LAMPUNG TAHUN 2020. Diploma thesis, Poltekkes Tanjungkarang.

MUTHMAINNAH, MUTHMAINNAH (2022) ASUHAN KEPERAWATAN PASIEN DENGAN GANGGUAN KEBUTUHAN RASA NYAMAN PADA KASUSPOST OPERASIMIOMA UTERITERHADAP Ny. S DI RUANG KEBIDANAN RSU HANDAYANIKOTABUMI LAMPUNG UTARATANGGAL 3-5 MARET 2022. Diploma thesis, Poltekkes Tanjungkarang.

MYLANDA, DHEA FEBRULIZA (2023) ASUHAN KEPERAWATAN PADA PASIEN CEPHALGIA DENGAN NYERI AKUT DI RUANG MELATI RUMAH SAKIT DKT DENKESYAH LAMPUNG TAHUN 2023. Diploma thesis, Poltekkes KemenkesTanjungkarang.

Maharani, Anissa Putri (2022) ASUHAN KEPERAWATAN ANAK DENGAN GANGGUAN KEBUTUHAN NUTRISI PADA KASUS STUNTING TERHADAP An.R DI WILAYAH KERJA PUSKESMAS KOTABUMI 2 KABUPATEN LAMPUNG UTARA 7-9 MARET 2022. Diploma thesis, Poltekkes Tanjungkarang.

Mardiani, Mardiani and Hermansyah, Hermansyah and Prayudhy, Yushananta (2018) Nurses' Performance Improvement Model in Hospital of Dr. M. Yunus Bengkulu, Indonesia. Diploma thesis, Poltekkes Tanjungkarang.

Meilita, Masti (2021) Asuhan Kebidanan Terhadap Ibu Nifas Pada Ny. M dengan Masalah Bendungan ASI di TPMB Eni Kurniawati S.ST Sumbersari Kec. Sekampung Kab. Lampung Timur. Diploma thesis, Poltekkes Tanjungkarang.

Meitasari, Reza (2021) Asuhan Kebidanan Pada Ibu Hamil dengan Anemia Ringan di TPMB F Kecamatan Purbolinggo Lampung Timur Tahun 2021. Diploma thesis, Poltekkes Tanjungkarang.

Melania, Amara Dwi (2021) UPAYA PENINGKATAN PENGETAHUAN DAN KETERAMPILAN MENYUSUI (Studi Literatur). Diploma thesis, Poltekkes Tanjungkarang.

Melinda Sari, Sari Melinda (2022) ASUHAN KEPERAWATAN PASIEN DENGAN GANGGUAN AMANNYAMANPADA KASUS CEDERAKEPALA SEDANG (CKS)TERHADAP Tn.S DI RUANG FRESIALANTAI 3RSU HANDAYANI KOTABUMI LAMPUNG UTARA TANGGAL 16-18 MARET 2022. Diploma thesis, Poltekkes Tanjungkarang.

Melinda Sari, Sari Melinda (2022) ASUHAN KEPERAWATAN PASIEN DENGAN GANGGUAN AMANNYAMANPADA KASUS CEDERAKEPALA SEDANG (CKS)TERHADAP Tn.S DI RUANG FRESIALANTAI 3RSU HANDAYANI KOTABUMI LAMPUNG UTARA TANGGAL 16-18 MARET 2022. Diploma thesis, Poltekkes Tanjungkarang.

Miranda, Aliya (2022) ASUHAN KEPERAWATAN PASIEN DENGAN GANGGUAN KEBUTUHAN CAIRAN PADA KASUS ABORTUS IMMINENS TERHADAP NY. E DI RUANG KEBIDANAN RSU HANDAYANIKOTABUMI LAMPUNG UTARA TANGGAL 01-03 MARET 2022. Diploma thesis, Poltekkes Tanjungkarang.

Misyati, Misyati (2022) ASUHAN KEPERAWATAN PASIEN DENGAN GANGGUAN NUTRISI DAN CAIRAN PADA KASUS DIABETES MELITUS TIPE 2 TERHADAP Tn. S DI RUANG MAWAR LANTAI 3 RSU HANDAYANI KOTABUMI KABUPATEN LAMPUNG UTARA TANGGAL 8-10 MARET 2022. Diploma thesis, Poltekkes Tanjungkarang.

Monica, Efria (2022) ASUHAN KEPERAWATANPASIENDENGANGANGGUANKEAMANDANPROTEKSI PADAKASUSDENGUEHEMORAGIC FEVER (DHF)TERHADAP Nn. R DI RUANG FRESIA RS HANDAYANIKOTABUMILAMPUNGUTARA TANGGAL07-09MARET2022. Diploma thesis, Poltekkes Tanjungkarang.

Muhabibi, Erwan (2022) ASUHAN KEPERAWATAN JIWA DENGAN GANGGUAN PERSEPSI SENSORIHALUSINASI PENDENGARAN PADA KASUS SKIZOFRENIA TERHADAP Tn. H DI RUANG KUTILANG RUMAH SAKIT JIWA DAERAH PROVINSI LAMPUNG TANGGAL 1 s.d 3 MARET 2021. Diploma thesis, Poltekkes Tanjungkarang.

Muhammad Haikal Putrahadi, Putrahadi Muhammad Haikal (2022) ASUHAN KEPERAWATAN PASIEN DENGAN GANGGUAN KESEIMBANGAN CAIRAN PADA KASUS GAGAL GINJAL KRONIKTERHADAP NY. L DIRUANG IGD RSU HANDAYANI KOTABUMILAMPUNG UTARA. Diploma thesis, Poltekkes Tanjungkarang.

Muhammad Ridho Aflah, Aflah Muhammad Ridho (2022) ASUHAN KEPERAWATAN KASUS STROKE NON HEMORAGIK DENGAN GANGGUAN OKSIGENASI TERHADAP Tn.J DI RUANG SARAF RSUD MAYJEND HM RYACUDU KOTABUMI LAMPUNG UTARA TANGGAL 21-25 FEBRUARI 2022. Diploma thesis, Poltekkes Tanjungkarang.

Murhan, AL and Purbianto, Purbianto and sulastri, sulastri (2020) PENGARUH RELAKSASI OTOT PROGRESIF TERHADAP PENURUNAN TEKANAN DARAH PADA LANSIA. Diploma thesis, Poltekkes Tanjungkarang.

Murhan, AL and Purbianto, Purbianto and sulastri, sulastri (2020) PENGARUH RELAKSASI OTOT PROGRESIF TERHADAP PENURUNAN TEKANAN DARAH PADA LANSIA. Diploma thesis, Poltekkes Tanjungkarang.

Murhan, Al and Aprina, Aprina (2020) Combination Of Extension And Triggering Methods Of Changes In Family Head Attitudes About Stop Open Defecation Free (ODF). Diploma thesis, Poltekkes Tanjungkarang.

Murhan, Al and Aprina, Aprina (2020) Combination Of Extension And Triggering Methods Of Changes In Family Head Attitudes About Stop Open Defecation Free (ODF). Diploma thesis, Poltekkes Tanjungkarang.

Murhan, Al and Aprina, Aprina (2020) Combination Of Extension And Triggering Methods Of Changes In Family Head Attitudes About Stop Open Defecation Free (ODF). Diploma thesis, Poltekkes Tanjungkarang.

Murhan, Al and Aprina, Aprina (2020) KORESPONDENSI : Combination Of Extension And Triggering Methods Of Changes In Family Head Attitudes About Stop Open Defecation Free(ODF). Diploma thesis, Poltekkes Tanjungkarag.

Murhan, Al and Aprina, Aprina (2021) KORESPONDENSI : Literatur Review: Pencegahan Infeksi Pada Ibu Melahirkan Di Masa Pandemic Covid-19. Diploma thesis, Poltekkes Tanjungkarag.

Murhan, Al and Aprina, Aprina (2020) LAIK ETIK : Combination Of Extension And Triggering Methods Of Changes In Family Head Attitudes About Stop Open Defecation Free (ODF). Diploma thesis, Poltekkes Tanjungkarag.

Murhan, Al and Aprina, Aprina (2021) LITERATUR REVIEW: PENCEGAHAN INFEKSI PADA IBU MELAHIRKAN DI MASA PANDEMIC COVID-19. Diploma thesis, Poltekkes Tanjungkarang.

Murhan, Al and Aprina, Aprina (2021) LITERATUR REVIEW: PENCEGAHAN INFEKSI PADA IBU MELAHIRKAN DI MASA PANDEMIC COVID-19. Diploma thesis, Poltekkes Tanjungkarang.

Murhan, Al and Aprina, Aprina (2021) LITERATUR REVIEW: PENCEGAHAN INFEKSI PADA IBU MELAHIRKAN DI MASA PANDEMIC COVID-19. Diploma thesis, Poltekkes Tanjungkarang.

Murhan, Al and Aprina, Aprina (2020) TURNITIN : Combination Of Extension And Triggering Methods Of Changes In Family Head Attitudes About Stop Open Defecation Free (ODF). Diploma thesis, Poltekkes Tanjungkarag.

Mutiara Annisa Octavia, Octavia Mutiara Annisa (2022) ASUHAN KEPERAWATAN GERONTIK Tn. M DENGAN GANGGUAN NYERI DAN KENYAMANAN PADA KASUS GOUT ARTHRITIS DI WILAYAH KERJA PUSKESMAS KOTABUMI II KABUPATEN LAMPUNG UTARA TANGGAL 21-25 FEBRUARI 2022. Diploma thesis, Poltekkes Tanjungkarang.

mareta, Resda (2022) ASUHAN KEPERAWATAN KELUARGA TERHADAP Ny.S DENGAN GANGGUAN NUTRISI DAN CAIRAN PADA KASUS DIABETES MELITUS TIPE 2 DI DUSUN TALANG SURABAYA DESA BANDAR PUTIH KEBUPATEN LAMPUNG UTARA TANGGAL 22-24 FEBRUARI 2022. Diploma thesis, Poltekkes Tanjungkarang.

mega, diah febiyana (2021) ASUHAN KEPERAWATAN GERONTIK DENGAN GANGGUAN NUTRISI DAN CAIRAN PADA KASUS DIABETES MELITUS TIPE II TERHADAP Ny. D DI DUSUN 10, DESA GONDANG REJO, KECAMATAN PEKALONGAN, KABUPATEN LAMPUNG TIMUR TANGGAL 22-27 MARET 2021. Diploma thesis, Poltekkes tanjungkarang.

N

NABIILAH, AULIYAH (2022) ASUHAN KEPERAWATAN GANGGUAN KEBUTUHAN AKTIVITAS PADA PASIEN ANEMIA KRONIK DI RUANG CENDRAWASIH II RUMAH SAKIT BHAYANGKARA TAHUN 2022. Diploma thesis, Poltekkes Tanjungkarang.

NABILA, ALYA (2022) HUBUNGAN PENDAMPINGAN SUAMI DENGAN KECEMASAN IBU PRESECTIO CAESAREA DI RUMAH SAKIT UMUM HANDAYANI KOTA BUMI TAHUN 2022. Diploma thesis, Poltekkes Tanjungkarang.

NABILA, ALYA (2023) PENERAPAN TERAPI RELAKSASI OTOT PROGRESIF TERHADAP KECEMASAN PASIENPRE SECTIO CAESAREA DI RS BHAYANGKARA POLDA LAMPUNG TAHUN 2023. Diploma thesis, Poltekkes Kemenkes Tanjungkarang.

NABILA, NISA ZULVA (2022) ASUHAN KEPERAWATAN GANGGUAN KEBUTUHAN NYERI DAN KENYAMANAN PADA PASIEN POST OPERASI PERITONITIS DI RSUD JENDRAL AHMAD YANI METRO TAHUN 2022. Diploma thesis, Poltekkes Tanjungkarang.

NABILA, SHELLYN (2021) ASUHAN KEPERAWATAN GANGGUAN THERMOREGULASI (HIPERTERMI) PADA REMAJA An.P KELUARGA Tn. Y DENGAN DEMAM THYPOID DI KEMILING BANDAR LAMPUNG TAHUN 2021. Diploma thesis, Poltekkes Tanjungkarang.

NABILAH, AMATULLAH (2022) ASUHAN KEPERAWATAN PERIOPERATIF PADA PASIEN DENGAN DIAGNOSIS MEDIS KISTA OVARIUM DEXTRA DENGAN PEMBEDAHAN SALPINGO-OOFOREKTOMI DI RUMAH SAKIT MARDI WALUYO KOTA METRO TAHUN 2022. Diploma thesis, Poltekkes Tanjungkarang.

NABILAH, LAILA ARIFAH (2023) ASUHAN KEPERAWATAN GANGGUAN PEMENUHAN KEBUTUHAN OKSIGENASI PADA NY. H DENGAN TUBERKULOSIS PARU DI RUANG PARU RUMAH SAKIT UMUM MAYJEND H.M. RYACUDU KOTABUMI TANGGAL 09 - 11 NOVEMBER 2022. Diploma thesis, Poltekkes Kemenkes Tanjungkarang.

NABILLA, ALVINIA (2020) ASUHAN KEPERAWATAN GANGGUAN KEBUTUHAN RASA NYAMAN NYERI PADA LANSIA DENGAN DERMATITIS DI UNIT PELAKSANA TEKNIS DAERAH PANTI SOSIAL LANJUT USIA TRESNA WERDHA NATAR LAMPUNG SELATAN. Diploma thesis, Poltekkes Tanjungkarang.

NADILA, ANISA SINTIA (2021) ASUHAN KEPERAWATAN KELUARGA TERHADAP Tn. K DENGAN GANGGUAN SISTEM PERNAFASAN PADA KASUS ASMA BRONKIALE DI DUSUN 09 GONDANG REJO KEC. PEKALONGAN KABUPATEN LAMPUNG TIMUR TANGGAL 25 - 27 MARET 2021. Diploma thesis, Poltekkes Tanjungkarang.

NAFISA, NURUL (2023) ASUHAN KEPERAWATAN PASIEN DENGAN GANGGUAN SIRKULASI PADA KASUS ANEMIA TERHADAP NY. I DI RUANG FRESIA LANTAI 4 RUMAH SAKIT UMUM HANDAYANI KOTABUMI LAMPUNG UTARA TANGGAL 09-11 NOVEMBER 2022. Diploma thesis, Poltekkes Kemenkes Tanjungkarang.

NAFI’AH, UMI (2022) ASUHAN KEPERAWATAN GANGGUAN KEBUTUHAN NUTRISI PADA PASIEN DIABETES MELITUS DI RUANG PENYAKIT DALAM B RSUD JENDRAL AHMAD YANI METRO PROVINSI LAMPUNG TAHUN 2022. Diploma thesis, Poltekkes Tanjungkarang.

NAGITA, DEWI (2021) ASUHAN KEPERAWATAN DENGAN GANGGUAN KEBUTUHAN OKSIGENASI PADA KASUS ASMA BRONKHIAL TERHADAP An. N DI RUANG ANAK RSU HANDAYANI KOTABUMI LAMPUNG UTARA TANGGAL 11-13 MARET 2021. Diploma thesis, Poltekkes Tanjungkarang.

NANDA, DOLA (2022) ASUHAN KEPERAWATAN PERIOPERATIF PADA PASIEN HEMOROID DENGAN TINDAKAN HEMOROIDEKTOMI DI RUANG BEDAH RS BHAYANGKARA POLDA LAMPUNG TAHUN 2022. Diploma thesis, Poltekkes Tanjungkarang.

NANDA, GUSTIA MEGA (2023) HUBUNGAN PERILAKU CARING PERAWAT DENGAN PENERAPAN STANDAR KESELAMATAN PASIEN (PENGURANGAN RISIKO INFEKSI) PADA PASIEN PERIOPERATIF DI RUANG BEDAH RUMAH SAKIT UMUM DAERAH Dr. H. ABDUL MOELOEK PROVINSI LAMPUNG. Diploma thesis, Poltekkes KemenkesTanjungkarang.

NASFA, LUFI FUADAH AZAR (2021) ASUHAN KEPERAWATAN NYERI KRONIS PADA KELUARGA BAPAK S DI TAHAP LANSIA IBU T DENGAN HIPERTENSI DI DESA BUMI KENCANA, DUSUN YPP KECAMATAN SEPUTIH AGUNG TAHUN 2021. Diploma thesis, Poltekkes Tanjungkarang.

NASTITI, ULFA SARI (2022) ASUHAN KEPERAWATAN PERIOPERATIF PADA PASIEN TUMOR GASTER DENGAN TINDAKAN GASTREKTOMI DI RUMAH SAKIT ABDUL MOELOEK PROVINSI LAMPUNG TAHUN 2022. Diploma thesis, Poltekkes Tanjungkarang.

NAZHALIA, NAZHIRA (2022) ASUHAN KEPERAWATAN GANGGUAN KEBUTUHAN NYERI DAN KENYAMANAN PADA PASIEN POST LAPARATOMY DI RUANG BEDAH RSUD JENDERAL AHMAD YANI METRO PROVINSI LAMPUNG TAHUN 2022. Diploma thesis, Poltekkes Tanjungkarang.

NAZHALIA, NAZHIRA (2022) ASUHAN KEPERAWATAN GANGGUAN KEBUTUHAN NYERI DAN KENYAMANAN PADA PASIEN POST LAPARATOMY DI RUANG BEDAH RSUD JENDERAL AHMAD YANI METRO PROVINSI LAMPUNG TAHUN 2022. Diploma thesis, Poltekkes Tanjungkarang.

NESA PRAMESTI MZ, MUTIARA (2023) PENATALAKSANAAN NYERI PADA PASIEN LOW BACK PAIN DAN POST OPERASI HERNIA INGUINALIS LATERAL DI RUANG BEDAH RUMAH SAKIT DR. A. DADI TJOKRODIPO KOTA BANDAR LAMPUNG TAHUN 2023. Diploma thesis, Poltekkes KemenkesTanjungkarang.

NEYZA, TARISS CAROLINE (2021) ASUHAN KEPERAWATAN PASIEN DENGAN GANGGUAN KEBUTUHAN KEAMANAN DAN PROTEKSI PADA KASUS ULKUS DIABETIKUM TERHADAP Tn.S DI RUANG BEDAH RSD MAYJEND HM.RYACUDU KOTABUMI LAMPUNG UTARA TANGGAL 11-13 MARET 2021. Diploma thesis, Poltekkes Tanjungkarang.

NIENDITA, RIKA ALVARE (2021) ASUHAN KEPERAWATAN PASIEN DENGAN GANGGUAN KEAMANAN DAN PROTEKSI PADA KASUS PRE EKLAMPSIA BERAT TERHADAP NY.M DI RUANG KEBIDANAN RSUD MAYJEND HM RYACUDU KOTABUMI LAMPUNG UTARA TANGGAL 8-10 MARET 2021. Diploma thesis, Poltekkes Tanjungkarang.

NINDI NS, SALSABILA (2021) ASUHAN KEPERAWATAN PASIEN DENGAN GANGGUAN AMAN NYAMAN PADA KASUS DISPEPSIA TERHADAP TN.S DI RUANG PENYAKIT DALAM RSUD MAYJEND HM RYACUDU KOTABUMI LAMPUNG UTARA TANGGAL 11-13 MARET 2021. Diploma thesis, Poltekkes Tanjungkarang.

NINGRUM, ANISA LIDIA (2021) ASUHAN KEPERAWATAN PASIEN DENGAN GANGGUAN OKSIGENASI PADA KASUS ANEMIA TERHADAP Tn. D DI RUANG FRESIA LANTAI 3 RSU HANDAYANI KOTABUMI LAMPUNG UTARA TANGGAL 08 – 10 MARET 2021. Diploma thesis, Poltekkes Tanjungkarang.

NINGRUM, SEPTI KURNIA (2021) ASUHANKEPERAWATAN GANGGUAN KEBUTUHAN NUTRISI PADA KELUARGA TN. P KHUSUSNYA NY. R DENGAN DIABETES MELITUSDI KEL.YOSOREJO KEC. METRO TIMURKOTA METRO PROVINSI LAMPUNG TAHUN 2021. Diploma thesis, Poltekkes Tanjungkarang.

NINGSIH, ANGGUN CITRA (2022) ASUHAN KEPERAWATAN GANGGUAN KEBUTUHAN RASANYAMAN (NYERI AKUT) PADA PASIEN DENGAN PERIOPERATIF ULKUS DIABETESMELITUSDI RUANG BEDAH UMUM RSUD JENDERAL AHMADYANI KOTAMETROLAMPUNG TAHUN2022. Diploma thesis, Poltekkes Tanjungkarang.

NINGSIH, ASTIA (2021) ASUHAN KEPERAWATAN GANGGUAN PEMENUHAN KEBUTUHAN AMAN NYAMAN:KECEMASAN PADA KELUARGA BAPAK F KHUSUSNYA IBU D PADA TAHAP PERKEMBANGAN CHILD BEARING DENGAN KEHAMILAN TRIMESTER III DALAM MENGHADAPI PERSALINAN DI SUKARAME BANDAR LAMPUNG TAHUN 2021. Diploma thesis, Poltekkes Tanjungkarang.

NINGSIH, DWI ENDARWATI (2021) ASUHAN KEPERAWATAN PERIOPERATIF PADA PASIEN FAM (FIBROADENOMA MAMMAE) DENGAN TINDAKAN EKSISI DI RUANG OK RSUD AHMAD YANI KOTA METRO TAHUN 2021. Diploma thesis, Poltekkes Tanjungkarang.

NINGSIH, ERVINA RESTU (2021) ASUHAN KEPERAWATAN GANGGUAN NUTRISI PADA KASUS HIPOGLIKEMIA TERHADAP Tn.R DIRUANG IGD RSUD JENDRAL AHMAD YANI METRO TANGGAL 06 APRIL 2021. Diploma thesis, Poltekkes Tanjungkarang.

NINGSIH, NINGSIH (2023) ASUHAN KEPERAWATAN GANGGUAN CITRA TUBUH PADAPASIEN POST MASTEKTOMIDENGAN INTERVENSI PROMOSI KOPINGDI RSBHAYANGKARA POLDALAMPUNG TAHUN 2023. Diploma thesis, Poltekkes Kemenkes Tanjungkarang.

NINGSIH, NINGSIH (2020) PENGARUH EDUKASI CITRA TUBUH TERHADAP MOTIVASI MERAWAT LUKA PASIEN POST MASTEKTOMI DI RSUD Dr. H. ABDUL MOELOEK PROVINSI LAMPUNG TAHUN 2020. Diploma thesis, Poltekkes Tanjungkarang.

NINGSIH, NOPI SETIA (2022) ASUHAN KEPERAWATAN GANGGUAN KEBUTUHAN CAIRAN PADA PASIEN CHF DI RUANG ICU RSUD JENDERAL AHMAD YANI KOTA METRO TAHUN 2022. Diploma thesis, Poltekkes Tanjungkarang.

NINGTYAS, APRILIA SETYA (2022) ASUHAN KEPERAWATAN PERIOPERATIF PADA PASIEN BENIGNA PROSTAT HYPERPLASIA DENGAN TINDAKAN TRANSURETHRAL RESECTION OF THE PROSTATE DI RSUD JENDRAL AHMAD YANI KOTA METRO TAHUN 2022. Diploma thesis, Poltekkes Tanjungkarang.

NINGTYAS, APRILIA SETYA (2021) PENGARUH PENDIDIKAN KESEHATAN DENGAN MEDIA BOOKLET TERHADAP KECEMASAN KELUARGA PASIEN PRE OPERASI SECTIO CAESAREA DI RSIA ANUGERAH MEDICAL CENTER KOTA METRO TAHUN 2021. Diploma thesis, Poltekkes Tanjungkarang.

NIRWANI, NIRWANI (2023) IMPLEMENTASITHERAPIRELAKSASIAUTOGENIK DALAMMENGATASINYERIAKUTPADAPASIENCHRONICKIDNEYDISEASE(CKD) DENGAN TINDAKAN OPERASI INSERSI CATHETER TENCKHOFFDIRUANGBEDAHRSUDdrHiABDULMOELOEK PROVINSI LAMPUNGTAHUN 2023. Diploma thesis, Poltekkes Kemenkes Tanjungkarang.

NISA, DIANA RATU (2022) ASUHAN KEPERAWATAN GANGGUAN KEBUTUHAN NYERI DAN KENYAMANANPADA PASIENPOST OPERASIHEMOROID DI RSTK. IV 02.07.04DENKESYAH 02.04.03 LAMPUNG TAHUN 2022. Diploma thesis, Poltekkes Tanjungkarang.

NISA, FIRZA NOVIATUN (2022) PENGARUH FOTONOVELA TERHADAP TINGKAT PEMAHAMAN ALUR OPERASI PASIEN LAPAROTOMY DI RSUD DR. H. ABDUL MOELOEK PROVINSI LAMPUNG TAHUN 2022. Diploma thesis, Poltekkes Tanjungkarang.

NISA, FIRZA NOVIATUN (2023) STUDI KASUS PADA PASIEN POST DEBRIDEMENT ULKUS DIABETIKUM DENGAN INTERVENSI INOVASI PERAWATAN LUKA MOIST WOUND HEALING DI RUMAH SAKIT MARDI WALUYO KOTA METRO TAHUN 2023. Diploma thesis, Poltekkes Kemenkes Tanjungkarang.

NISA, WIDYA KHOIROTUN (2022) ASUHAN KEPERAWATAN PASIEN DENGAN GANGGUAN RASA NYAMAN PADA KASUS POST PARTUM TERHADAP Ny. N DI RUANG KEBIDANAN RSU HANDAYANI KOTABUMI LAMPUNG UTARA TANGGAL 01-03 MARET 2022. Diploma thesis, Poltekkes Tanjungkarang.

NISRINITYA, IFFA (2022) ASUHAN KEPERAWATAN PERIOPERATIF PADA PASIEN NY.E DENGAN DIAGNOSA KISTA BARTHOLINI DENGAN TINDAKAN MARSUPIALISASI DI RUMAH SAKIT BHAYANGKARA POLDA LAMPUNG TAHUN 2022. Diploma thesis, Poltekkes Tanjungkarang.

NISYAH, RISA HAIRUN (2021) ASUHAN KEPERAWATAN PERIOPERATIF PADA PASIEN TROMBOANGITIS OBLITERANS DENGAN TINDAKAN AMPUTASI PEDIS DEXTRA DI RUANG OPERASI RSUD Dr. H. BOB BAZAR, SKM KALIANDA TAHUN 2021. Diploma thesis, Poltekkes Tanjungkarang.

NISYAH, RISA HAIRUN (2020) PENGARUH MOBILISASI DINI 24 JAM PERTAMA TERHADAP PENURUNAN SKALA NYERI PADA PASIEN POST OPERASI SECTIO CAESAREA DI RSUD DR. H. ABDUL MOELOEK PROVINSI LAMPUNG TAHUN 2020. Diploma thesis, Poltekkes Tanjungkarang.

NOPITA, DESTI (2022) ASUHAN KEPERAWATAN GANGGUAN KEBUTUHAN NYERI DAN KENYAMANAN (NYERI AKUT) PADA PASIEN ULKUS DIABETIKUM DI RS TK IV 02.07.04 DENKESYAH LAMPUNG TAHUN 2022. Diploma thesis, Poltekkes Tanjungkarang.

NOPRIKA, ADINDA DELLA (2022) ASUHAN KEPERAWATAN PERIOPERATIF PADA PASIEN ULKUS DIABETIKUM DENGAN TINDAKAN DEBRIDEMEN DI RUMAH SAKIT MARDI WALUYO METRO TAHUN 2022. Diploma thesis, Poltekkes Tanjungkarang.

NORDI, THALIA NADIRA (2022) ASUHAN KEPERAWATAN PERIOPERATIF PADA PASIEN BENIGNA PROSTAT HIPERPLASIA DENGAN TINDAKAN TRANSURETHRAL RESECTION OF THE PROSTATE (TURP) DI RUMAH SAKIT ABDUL MOELOEK PROVINSI LAMPUNG TAHUN 2022. Diploma thesis, Poltekkes Tanjungkarang.

NORDI, THALIA NADIRA (2022) ASUHAN KEPERAWATAN PERIOPERATIF PADA PASIEN BENIGNA PROSTAT HIPERPLASIA DENGAN TINDAKAN TRANSURETHRAL RESECTION OF THE PROSTATE (TURP) DI RUMAH SAKIT ABDUL MOELOEK PROVINSI LAMPUNG TAHUN 2022. Diploma thesis, Poltekkes Tanjungkarang.

NOVIA, PUTRI FINKA (2021) ASUHAN KEPERAWATAN PERIOPERATIF PADA Nn.V DENGAN DIAGNOSA MEDIS APPEDICITIS DENGAN TINDAKAN OPERASI APPENDIKTOMI DI RUANG OPERASI RSUD dr. H. BOB BAZAR., SKM KALIANDA TAHUN 2021. Diploma thesis, Poltekkes Tanjungkarang.

NOVIANA, TESI (2022) ASUHAN KEPERAWATAN PERIOPERATIF PADA PASIEN ULKUS DIABETIKUM DENGAN TINDAKAN DEBRIDEMEN DI RS BHAYANGKARA POLDA LAMPUNG TAHUN 2022. Diploma thesis, Poltekkes Tanjungkarang.

NOVIANTO, DANY (2022) ASUHAN KEPERAWATAN PERIOPERIF PADA PASIEN PERITONITIS DENGAN TINDAKAN LAPARATOMI EKSPLORASI DI RSUD JENDERAL AHMAD YANI METRO LAMPUNG TAHUN 2022. Diploma thesis, Poltekkes Tanjungkarang.

NOVIANTO, DANY (2022) HUBUNGAN FAMILY SUPPORT DENGAN KECEMASAN PADA PASIEN PRE OPERASI DI RSUD JENDERAL AHMAD YANI METRO LAMPUNG TAHUN 2021. Diploma thesis, Poltekkes Tanjungkarang.

NOVILIA, MELSA (2020) ASUHAN KEPERAWATAN PERIOPERATIF PADA KASUS LIMFADENOPATI KLAVIKULA DENGAN TINDAKAN EKSISI DIRUANG OPERASI RS DKT BANDAR LAMPUNG TAHUN 2020. Diploma thesis, Poltekkes Tanjungkarang.

NOVITA, FENNY (2022) ASUHAN KEPERAWATAN GANGGUAN KEBUTUHAN OKSIGENASI PADA PASIEN TUBERKULOSIS PARU DI RUMAH SAKIT BHAYANGKARA POLDA LAMPUNG TAHUN 2022. Diploma thesis, Poltekkes Tanjungkarang.

NOVITA, MITA (2022) ASUHAN KEPERAWATAN GANGGUAN KEBUTUHANSIRKULASI PADA PASIEN ANEMIA DIRUMAH SAKIT BHAYANGKARA POLDALAMPUNG TAHUN 2022. Diploma thesis, Poltekkes Tanjungkarang.

NOVITA, XANTIA (2023) LATIHANANKLE PUMPUNTUK MENGATASI MASALAH KEPERAWATAN NYERI AKUT PADA PASIEN POST OP TOTAL HIP REPLACEMENT e.cOSTEROARTHRITIS DI RUANG BEDAH RSUD DR HI ABDUL MOELOEK PROVINSI LAMPUNG. Diploma thesis, Poltekkes Kemenkes Tanjungkarang.

NOVITASARI, NOVITASARI (2023) ASUHAN KEPERAWATAN PASIEN DENGAN GANGGUAN NUTRISI DAN CAIRAN PADA KASUS HIPEREMESIS GRAVIDARUM TERHADAP Ny. I Di RUANG KEBIDANAN RSU HANDAYANI KOTABUMI LAMPUNG UTARA TANGGAL 31 MARET-02APRIL 2023. Diploma thesis, Poltekkes Kemenkes Tanjungkarang.

NOVITASARI, RAHMA (2022) ASUHAN KEPERAWATAN PERIOPERATIF PADA PASIEN TUMOR MEDIASTINUM DENGAN TINDAKAN BRONKOSKOPI DI RSUD JENDRAL AHMAD YANI METRO TAHUN 2022. Diploma thesis, Poltekkes Tanjungkarang.

NOVITRI, DINI (2021) ASUHAN KEPERAWATAN DENGAN GANGGUAN NYERI KRONIS:RHEUMATOID ARTHRITIS PADA KELUARGA LANSIA BAPAK N DI DESA SUMBER HARJO KABUPATEN OKU TIMUR SUMATERA SELATAN TAHUN 2021. Diploma thesis, Poltekkes Tanjungkarang.

NOVLIZA, ULFA (2022) ASUHAN KEPERAWATAN PERIOPERATIF PADA PASIEN OSTEOARTHRITIS DENGAN TINDAKAN TOTAL KNEE REPLACEMENT DI RSUD JENDERAL AHMAD YANI METRO TAHUN 2022. Diploma thesis, Poltekkes Tanjungkarang.

NOVRIYANI, RIRIS (2021) ASUHAN KEPERAWATAN KELUARGA LANSIA DENGAN GANGGUAN KEBUTUHAN RASA NYAMAN NYERI AKUT PADA TN. E PENDERITA HIPERTENSI DI KELURAHAN WAY DADI BARU KECAMATAN SUKARAME BANDAR LAMPUNG TAHUN 2021. Diploma thesis, Poltekkes Tanjungkarang.

NUR, MEYSI (2020) ASUHAN KEPERAWATAN GANGGUAN KEBUTUHAN OKSIGENASI PADA ANAK ISPA DI RUANG ANAK RSUD JENDRAL AHMAD YANI KOTA METRO PROVINSI LAMPUNG TAHUN 2020. Diploma thesis, Poltekkes Tanjungkarang.

NUR SAFITRI, AZZAHRA (2023) ASUHAN KEPERAWATAN GANGGUAN KEBUTUHAN RASA NYAMAN (NYERI) PADA PASIEN POST OPERASI HERNIA INGUINALIS DI RUMAH SAKIT TK IV DENKENSYAH LAMPUNG TAHUN 2023. Diploma thesis, Poltekkes KemenkesTanjungkarang.

NURAIDI, MAUDINA PUTRI (2021) ASUHAN KEPERAWATAN GANGGUAN KEBUTUHAN BELAJAR : DEFISIT PENGETAHUAN TENTANG VULVA HYGIENE PADA KELUARGA BP. H KHUSUSNYA AN. E DI KELURAHAN PRINGSEWU TAHUN 2021. Diploma thesis, Poltekkes Tanjungkarang.

NURAINI, DEWI (2021) ASUHAN KEPERAWATAN GANGGUAN NYERI KRONIS USIA PERTENGAHAN PADA BAPAK T KELUARGA BAPAK T DENGAN GOUT ARTHRITIS DI DESA GEDUNG SURIAN KEC. GEDUNG SURIAN KABUPATEN LAMPUNG BARAT TAHUN 2021. Diploma thesis, Poltekkes Tanjungkarang.

NURAINI, FIRDA (2020) ASUHAN KEPERAWATAN DENGAN GANGGUAN PEMENUHAN KEBUTUHAN DISTRESS SPIRITUAL PADA PASIEN DENGAN DIAGNOSA MEDIS PENYAKIT PULMONARI OBSTRUKSI KRONIK (PPOK) DI RUANG PARU RSUD JENDRAL AHMAD YANI METRO PROVINSI LAMPUNG TAHUN 2020. Diploma thesis, Poltekkes Tanjungkarang.

NURASIH, CUCUM (2023) ASUHAN KEPERAWATAN DENGAN GANGGUAN PEMENUHAN KEBUTUHAN RASA NYAMAN; NYERI DAN KENYAMANAN PADA PASIEN HIPERTENSI DESA SRIMULYO 1 NATAR LAMPUNG SELATAN TAHUN 2023. Diploma thesis, Poltekkes KemenkesTanjungkarang.

NURDEVA, SITI (2022) ASUHAN KEPERAWATAN PERIOPERATIF PADA PASIEN APPENDISITIS DENGAN TINDAKAN APPENDICTOMY DI RUMAH SAKIT BHAYANGKARA POLDA PROVINSI LAMPUNG TAHUN 2022. Diploma thesis, Poltekkes Tanjungkarang.

NURFITRI, MUTIARA RIZKY (2022) ASUHAN KEPERAWATAN GANGGUAN KEBUTUHAN NYERI DAN KENYAMANAN PADA PASIEN DIABETES MELITUS DI RUANG PENYAKIT DALAM A RSUD JENDRAL AHMAD YANI KOTA METRO TAHUN 2022. Diploma thesis, Poltekkes Tanjungkarang.

NURHAMID, NURHAMID (2021) ASUHAN KEPERAWATAN PERIOPERATIF PADA PASIEN NEFROLITIASIS DEXTRA DENGAN TINDAKAN NEFROLITOTOMI DI RUANG IBS RSUD DR. H. ABDUL MOLOEK PROVINSI LAMPUNG TAHUN 2021. Diploma thesis, Poltekkes Tanjungkarang.

NURHASANAH, QURROTA A’YUN (2023) PENGARUH KOMBINASI KOMPRES HANGAT DAN AFIRMASI POSITIF TERHADAP PENGELUARAN KOLOSTRUM PADA PASIEN POST OPERASI SECTIO CAESAREA DI RSIA ANUGERAH MEDICAL CENTRE KOTA METRO TAHUN 2023. Diploma thesis, Poltekkes Kemenkes Tanjungkarang.

NURIYAWATI, JANA (2023) ASUHAN KEPERAWATAN PADA PASIEN DENGAN GANGGUAN PERSEPSI SENSORI: HALUSINASI PENDENGARAN PADA KASUS SKIZOFRENIA PARANOID TERHADAP NY. S DI RUANG MELATI RUMAH SAKIT JIWA DAERAH PROVINSI LAMPUNG TANGGAL 21 s.d. 23 MARET 2022. Diploma thesis, Poltekkes Kemenkes Tanjungkarang.

NURJANAH, KAMILIA (2021) ASUHAN KEPERAWATAN KELUARGA GANGGUAN KEBUTUHAN NYERI AKUT PADA REMAJA An. M KELUARGA BAPAK S DENGAN HEMOROID DI KELURAHAN SUKABUMI BANDAR LAMPUNG TAHUN 2021. Diploma thesis, Poltekkes Tanjungkarang.

NURMALA, AGITHA NANDA (2021) ASUHAN KEPERAWATAN PERIOPERATIF PADA PASIEN HERNIA INGUINALIS DEXTRA DENGAN TINDAKAN HERNIOTOMY HERNIORAPHY DI RUANG OPERASI RUMAH SAKIT YUKUM MEDICAL CENTRE LAMPUNG TENGAH TAHUN 2021. Diploma thesis, Poltekkes Tanjungkarang.

NURMALIYA, ILMAIDA (2020) ASUHAN KEPERAWATAN PADA PASIEN TRAUMA INTRA ABDOMEN DENGAN TINDAKAN LAPARATOMI EKSPLORASI DI RS PERTAMINA BINTANG AMIN BANDAR LAMPUNG TAHUN 2020. Diploma thesis, Poltekkes Tanjungkarang.

NURRIA, SINTHA (2021) ASUHAN KEPERAWATAN KELUARGA TERHADAP Ny.P DENGAN GANGGUAN NYERI AKUT PADA KASUS HIPERTENSI DI DESA TANJUNG AMAN KECAMATAN KOTABUMI SELATAN KABUPATEN LAMPUNG UTARA TANGGAL 23 s.d 27 MARET 2021. Diploma thesis, Poltekkes Tanjungkarang.

NURSAFITRI, EKA (2021) ASUHAN KEPERAWATAN GANGGUAN NYERIPADA IBU.T KELUARGA BAPAK. S DENGAN HIPERTENSI DI DESA TEGALSARI KECAMATAN GISTING KABUPATEN TANGGAMUS TAHUN 2021. Diploma thesis, Poltekkes Tanjungkarang.

NUR’ AINI, NUR’ AINI (2022) ASUHAN KEPERAWATAN PERIOPERATIF PADA PASIEN TRAUMA TUMPUL ABDOMEN E.C. PERITONITIS DENGAN TINDAKAN LAPARATOMI DAN KOLOSTOMI DI RSUD JENDERAL AHMAD YANI METRO TAHUN 2022. Diploma thesis, Poltekkes Tanjungkarang.

NUR’AINI, NUR’AINI (2021) ASUHAN KEPERAWATAN PASIEN DENGAN GANGGUAN KEBUTUHAN SIRKULASI PADA KASUS PRE-EKLAMPSIA BERAT TERHADAP Ny.T DIRUANG KEBIDANAN RSUD MAYJEND HM RYACUDU KOTABUMI LAMPUNG UTARA TANGGAL 11-13 MARET 2021. Diploma thesis, Poltekkes Tanjungkarang.

NUSAIBAH, NADA (2022) ASUHAN KEPERAWATAN PERIOPERATIF PADA PASIEN SOFT TISSUE TUMOR MULTIPLE PUNGGUNG DENGAN TINDAKAN MULTIPLE EKSISI DI RUMAH SAKIT BHAYANGKARA POLDA LAMPUNG TAHUN 2022. Diploma thesis, Poltekkes Tanjungkarang.

NUSWANTORO, ADJI MAS (2021) ASUHAN KEPERAWATAN GANGGUAN PEMENUHAN KEBUTUHAN NUTRISI DENGAN MALNUTRISI PADA ANAK Z DI KELUARGA BAPAK I DI KECAMATAN PAGELARAN KABUPATEN TANGGAMUS TAHUN 2021. Diploma thesis, Poltekkes Tanjungkarang.

NUZULIAH, HIKMATIN (2023) ASUHAN KEPERAWATAN GANGGUAN KEBUTUHAN AMAN NYAMAN PADA PASIEN TYPHOID DIKELAS 2-3 RUMAH SAKIT BHAYANGKARA POLDA LAMPUNG TAHUN 2023. Diploma thesis, Poltekkes KemenkesTanjungkarang.

Nainggolan, Rahayu (2021) ASUPAN NATRIUM, KALIUM, DAN TEKANAN DARAH PENDERITA HIPERTENSI (Study Literature) TAHUN 2021. Diploma thesis, Poltekkes Tanjungkarang.

Napitu, Rakhel Roma Tua (2022) ASUHAN KEPERAWATAN PASIEN DENGAN GANGGUAN KEBUTUHAN CAIRAN PADA KASUS GASTROENTERITIS TERHADAP Ny.S DI RUANG PENYAKIT DALAM RSD MAYJEN HM RYACUDU KOTABUMI LAMPUNG UTARA TANGGAL 08-10 NOVEMBER 2021. Diploma thesis, Poltekkes Tanjungkarang.

Ningtyas, Histi Wahyu (2021) GAMBARAN KADAR HEMOGLOBIN DAN JUMLAH TROMBOSIT PADA PENDERITA MALARIA DI PUSKESMAS KOTA KARANG BANDAR LAMPUNG. Diploma thesis, Poltekkes Tanjungkarang.

Nora, Dyna Selvia (2022) ASUHAN KEPERAWATAN PADA KASUS PNEUMONIA DENGAN GANGGUAN OKSIGENASI TERHADAP TN.N DI RUANG PENYAKIT DALAM RSUD MAYJEND HM RYACUDU KOTABUMI LAMPUNG UTARA 28 FEBRUARI – 04 MARET 2022. Diploma thesis, Poltekkes Tanjungkarang.

Nugroho, Arie (2020) History of Breastfeeding, Formula and Eating Patterns in Stunted Toddlers: The Case with Picky Eaters. Diploma thesis, Poltekkes Tanjung Karang.

Nugroho, Arie (2021) Piring model T meningkatkan pengetahuan terkait obesitas pada remaja. Diploma thesis, Poltekkes Tanjung Karang.

Nugroho, Arie and Bertalina, Bertalina and Marlina, Marlina (2015) HUBUNGAN ANTARA ASUPAN ZAT GIZI DAN STATUS GIZI DENGAN KEJADIAN MENARCHE DINI PADA SISWI SD NEGERI 2 DI KOTA BANDAR LAMPUNG. Diploma thesis, Poltekkes Tanjungkarang.

Nuhan, Khairul and Astuti, Titi and Murhan, Al (2018) Pengaruh Murottal Al-Qur’an terhadap Intensitas Nyeri pada Pasien Post Operasi Sectio Caesarea. Diploma thesis, Poltekkes Tanjungkarang.

Nuhan, Khairul and Astuti, Titi and Murhan, Al (2018) Pengaruh Murottal Al-Qur’an terhadap Intensitas Nyeri pada Pasien Post Operasi Sectio Caesarea. Diploma thesis, Poltekkes Tanjungkarang.

Nurkhoiriyah, Yustin and Murwaningsih, Sri (2018) Kajian Ragam dan Periode Penyimpanan Kombinasi Air Rebusan Daun Sirih dan Kayu Siwak Terhadap Pertumbuhan Streptococcus mutans. Diploma thesis, Poltekkes Tanjungkarang.

Nurminha, Nurminha and Sugiarti, Mimi (2018) Hubungan Derajat Keparahan DBD Dengan Kadar Albumin Pada Penderita Demam Berdarah Dengue Di RSUD Dr. H. Abdul Moeloek Provinsi Lampung. Diploma thesis, Poltekkes Tanjungkarang.

Nurminha, Nurminha and Sugiarti, Mimi and Aulia, Mahrifa Gita (2018) Hubungan Derajat Keparahan DBD Dengan Kadar Albumin Pada Penderita Demam Berdarah Dengue Di RSUD Dr. H. Abdul Moeloek Provinsi Lampung. Diploma thesis, Poltekkes Tanjungkarang.

nabila, lutfiah amani (2021) ASUHAN KEPERAWATAN KELUARGA TERHADAP Ny.R DENGAN GANGGUAN RASA AMAN NYAMAN PADA KASUS HIPERTENSI DI DESA TANJUNG AMAN KEC. KOTABUMI SELATAN KAB. LAMPUNG UTARA TANGGAL 24 s.d 26 MARET 2021. Diploma thesis, Poltekkes tanjungkarang.

O

OBARA, SEPTA (2020) ASUHAN KEPERAWATAN PERIOPERATIF PASIEN DENGAN DIAGNOSA FRAKTUR KLAVIKULA DENGAN TINDAKAN OPERASI ORIF (OPEN REDUCTION INTERNAL FIXATION) DI RUANG OPERASI RUMAH SAKIT DKT BANDAR LAMPUNG TAHUN 2020. Diploma thesis, Poltekkes Tanjungkarang.

OCTAVIA, TIKA (2020) ASUHAN KEPERAWATAN DENGAN GANGGUAN KEBUTUHAN OKSIGEN PADA PASIEN PENYAKIT PARU OBSTRUKTIF KRONIS (PPOK) DI RUANG PARU RSUD JENDRAL AHMAD YANI KOTA METRO TAHUN 2020. Diploma thesis, Poltekkes Tanjungkarang.

OCTHARIA, OCTHARIA (2020) ASUHAN KEPERAWATAN PASIEN DENGAN GANGGUAN OKSIGENASI PADA KASUS CONGESTIVE HEART FAILURE TERHADAP TN.S DI RUANG PENYAKIT DALAM FREESIA LANTAI 3 RSU HANDAYANI KOTABUMI LAMPUNG UTARA TANGGAL 28-31 OKTOBER 2019. Diploma thesis, Poltekkes Tanjungkarang.

OKCIANA, INDAH (2023) IMPLEMENTASI KEPERAWATAN TEKNIK RELAKSASI AROMATERAPI LAVENDER PADA PASIEN POST HEMOROIDEKTOMI DENGAN NYERI AKUT DI RSUD JENDERAL AHMAD YANI KOTA METRO TAHUN 2023. Diploma thesis, Poltekkes Kemenkes Tanjungkarang.

OKMALITA, SHELVIRA (2021) ASUHAN KEPERAWATAN TERHADAP Ny. W DENGAN GANGGUAN AMAN NYAMAN NYERI AKUT PADA KASUS POST OP HEMOROID DI RUANG BEDAH RSD MAYJEND HM RYACUDU KOTABUMI LAMPUNG UTARA TANGGAL 11-13 MARET 2021. Diploma thesis, Poltekkes Tanjungkarang.

OKTANDI, RIDHO FERRAN (2022) ASUHAN KEPERAWATAN GANGGUAN KEBUTUHAN NYERI DAN KENYAMANAN PADA PASIEN ULKUS DIABETIKUM DI RS.TK.IV.02.07.04 DENKESYAH 02.04.03 BANDAR LAMPUNG TAHUN 2022. Diploma thesis, Poltekkes Tanjungkarang.

OKTANTYASARI, OKTANTYASARI (2021) ASUHAN KEPERAWATAN GANGGUAN PEMENUHAN KEBUTUHAN HIPERTENSI: RASA AMAN NYAMAN NYERI PADA KELUARGA BAPAK Tn.T KHUSUSNYA NY.TS DI HAJIMENA NATAR KABUPATEN LAMPUNG SELATAN TAHUN 2021. Diploma thesis, Poltekkes Tanjungkarang.

OKTARI, MELLY (2021) ASUHAN KEPERAWATAN GANGGUAN KEBUTUHAN RASA NYAMAN NYERI GASTRITIS PADA ANAK USIA REMAJA KHUSUSNYA AN.T KELUARGA NY.R DI DESA BELU KOTAAGUNG TAHUN 2021. Diploma thesis, Poltekkes Tanjungkarang.

OKTARIANI, DIAH AYU (2022) ASUHAN KEPERAWATAN PERIOPERATIF HEMOROIDEKTOMI PADA PASIEN DENGAN HEMOROID DI RUMAH SAKIT MARDI WALUYO METRO. Diploma thesis, Poltekkes Tanjungkarang.

OKTARIDHO, A RIZQI (2022) ASUHAN KEPERAWATAN DENGAN KEBUTUHAN OKSIGENASIPADA PASIEN ACUTE LUNGS ODEMA (ALO) DI RUANGJANTUNG RSUD JENDERAL AHMAD YANI KOTA METRO TAHUN 2022. Diploma thesis, Poltekkes Tanjungkarang.

OKTARINA, LIA (2022) ASUHAN KEPERAWATAN PERIOPERATIF PADA PASIEN UROLITHIASIS DENGAN TINDAKAN URETEROSCOPIC LITHOTRIPSY DI RSUD JENDERAL AHMAD YANI METRO TAHUN 2022. Diploma thesis, Poltekkes Tanjungkarang.

OKTARINA, LIA (2021) PENGARUH FOOTBATH THERAPY TERHADAP PENURUNAN SKALA NYERI PADA IBU POST SECTIO CAESAREA DI RSU MUHAMMADIYAH METRO PROVINSI LAMPUNG TAHUN 2021. Diploma thesis, Poltekkes Tanjungkarang.

OKTARINA, LIA and Aprina, Aprina and Purwati, Purwati (2022) KORESPONDENSI : Pengaruh Footbath Therapy terhadap Penurunan Skala Nyeri pada Ibu Post Sectio Caesarea. Diploma thesis, Poltekkes Tanjungkarag.

OKTARINA, LIA and Aprina, Aprina and Purwati, Purwati (2022) LAIK ETIK : Pengaruh Footbath Therapy terhadap Penurunan Skala Nyeri pada Ibu Post Sectio Caesarea. Diploma thesis, Poltekkes Tanjungkarag.

OKTARINA, LIA and Aprina, Aprina and Purwati, Purwati (2022) TURNITIN : Pengaruh Footbath Therapy terhadap Penurunan Skala Nyeri pada Ibu Post Sectio Caesarea. Diploma thesis, Poltekkes Tanjungkarag.

OKTARIYANTI, SYAFHIRA (2022) ASUHAN KEPERAWATAN PERIOPERATIF PADA PASIEN GYNECOMASTIA DENGAN TINDAKAN MASTECTOMY DI RS BHAYANGKARA POLDA LAMPUNG TAHUN 2022. Diploma thesis, Poltekkes Tanjungkarang.

OKTAVIA, BERLIANA (2023) FAKTOR-FAKTOR YANG BERHUBUNGAN DENGAN KELANCARAN ASI PADA IBU POST SEKSIO SESAREA DI RSIA ANUGERAH MEDICAL CENTER PROVINSI LAMPUNG TAHUN 2023. Diploma thesis, Poltekkes Kemenkes Tanjungkarang.

OKTAVIANA, OKTAVIANA (2023) ASUHAN KEPERAWATAN NYERI AKUT PADA PASIEN POST APPENDIKTOMI DENGAN APLIKASI TERAPI MUROTTAL AL-QUR’AN DI RUMAH SAKIT BHAYANGKARA BANDAR LAMPUNG TAHUN 2023. Diploma thesis, Poltekkes Kemenkes Tanjungkarang.

OKTAVIANA, RARA (2023) ASUHAN KEPERAWATAN GANGGUAN KEBUTUHAN NUTRISI PADA PASIEN DENGAN DIABETES MELITUS DI RUANG PENYAKIT DALAM RSUD A. DADI TJOKRODIPO BANDAR LAMPUNG TAHUN 2023. Diploma thesis, Poltekkes KemenkesTanjungkarang.

OKTAVIANA, TRISIYA NURHASANAH (2021) ASUHAN KEPERAWATAN DENGAN GANGGUAN RASA AMAN NYAMAN : NYERI PADA KASUS DIABETES MELITUS TIPE 2 TERHADAP Ny. A DI RUANG PENYAKIT DALAM RSD MAYJEND HM RYACUDU KOTABUMI LAMPUNG UTARA TANGGAL 11-13 MARET 2021. Diploma thesis, Poltekkes Tanjungkarang.

OKTAVIANA, VENTY LIA (2022) ASUHAN KEPERAWATAN DENGAN GANGGUAN KEBUTUHAN NUTRISI PADA PASIEN DIABETES MELITUS DI RUANG PENYAKIT DALAM RSUD Dr. A. DADI TJOKRODIPO BANDAR LAMPUNG TAHUN 2022. Diploma thesis, Poltekkes Tanjungkarang.

OKTAVIANI, RISKA (2023) ASUHAN KEPERAWATAN GANGGUAN KEBUTUHAN ISTIRAHAT DAN TIDUR PADA KLIEN HIPERTENSI DI DUSUN SRIMULYO 1 DESA PEMANGGILAN KECAMATAN NATAR LAMPUNG SELATAN TAHUN 2023. Diploma thesis, Poltekkes KemenkesTanjungkarang.

OKTAVIANTI, MUTIARA (2021) ASUHAN KEPERAWATAN GANGGUAN KEBUTUHAN RASA NYAMAN PADA REMAJA AN.F KELUARGA BAPAK A DENGAN DERMATITIS DI DESA TALANG PADANG TANGGAMUS LAMPUNG TAHUN 2021. Diploma thesis, Poltekkes Tanjungkarang.

OPERASETIYA, EU NIKE (2023) HUBUNGAN KOMUNIKASI TERAPEUTIK PERAWAT DENGAN PENURUNAN TINGKAT KECEMASAN PASIEN PRE OPERASI DI RUMAH SAKIT MARDI WALUYO KOTA METRO TAHUN 2023. Diploma thesis, Poltekkes KemenkesTanjungkarang.

Octa Nihando Rokawic, Agung and sulastri, sulastri and anita, anita (2017) RELAKSASI NAFAS DALAM MENURUNKAN KECEMASAN PASIEN PRE OPERASI BEDAH ABDOMEN. Diploma thesis, Poltekkes Tanjungkarang.

Octa Nihando Rokawic, Agung and sulastri, sulastri and anita, anita (2017) RELAKSASI NAFAS DALAM MENURUNKAN KECEMASAN PASIEN PRE OPERASI BEDAH ABDOMEN. Diploma thesis, Poltekkes Tanjungkarang.

Octaviana, Amrina and Indrasari, Nelly (2021) PARITAS, USIA, DAN JARAK KELAHIRAN TERHADAP KEJADIAN ANEMIA PADA IBU HAMIL. Diploma thesis, Poltekkes Tanjungkarang.

Oktaviana, Tika (2021) ASUHAN KEPERAWATAN KELUARGA GANGGUAN KEBUTUHAN NYERI PADA KELUARGA DEWASA LANJUT BP. T KHUSUSNYA IBU M DENGAN GOUT ARTHTRITIS DI DESA SUMBER BARU KECAMATAN SEPUTIH BANYAK KABUPATEN LAMPUNG TENGAH TAHUN 2021. Diploma thesis, Poltekkes Tanjungkarang.

P

PALUPI, RAMONA RESTI (2022) ASUHAN KEPERAWATAN PASIEN DENGAN GANGGUAN RASA AMAN DAN NYAMAN PADA KASUS UROLITHIASIS TERHADAP Tn.A DI RUANG BEDAH RSUD MAYJEND HM RYACUDU KOTABUMI LAMPUNG UTARA TANGGAL 15-16 NOVEMBER 2021. Diploma thesis, Poltekkes Tanjungkarang.

PAMBUDI, RADITYA DWI (2021) ASUHAN KEPERAWATAN PERIOPERATIF PADA PASIEN CA COLON DENGAN TINDAKAN LAPARATOMI DI RUANG OPERASIRUMAH SAKIT UMUM DAERAH JENDRAL AHMAD YANI METRO TAHUN 2021. Diploma thesis, Poltekkes Tanjungkarang.

PAMUNGKAS, TSALIS INDAH (2020) ASUHAN KEPERAWATAN PERIOPERATIF PADA PASIEN BENIGNA PROSTAT HIPERPLASIA DENGAN TINDAKAN PROSTATEKTOMI DI RUANG OPERASI RUMAH SAKIT MARDI WALUYO KOTA METRO TAHUN 2020. Diploma thesis, Poltekkes Tanjungkarang.

PANDWI, SANOVAL AJI (2023) PENGARUH TEKNIK HIPNOSIS LIMA JARI TERHADAP KECEMASAN PADA PASIEN PRE OPERASI SEKSIO SESAREA DI RSIA ANUGERAH MEDIKAL CENTER METRO LAMPUNG TAHUN 2023. Diploma thesis, Poltekkes KemenkesTanjungkarang.

PANGESTU, BAGAS AJI (2022) ASUHAN KEPERAWATAN GANGGUAN PEMENUHAN KEBUTUHAN NUTRISI PADA PASIEN ANEMIA DI RUANG PENYAKIT DALAM B RSUD JENDRAL AHMAD YANI KOTA METRO TAHUN 2022. Diploma thesis, Poltekkes Tanjungkarang.

PANGESTU, BAGAS AJI (2022) ASUHAN KEPERAWATAN GANGGUAN PEMENUHAN KEBUTUHAN NUTRISI PADA PASIEN ANEMIA DI RUANG PENYAKIT DALAM B RSUD JENDRAL AHMAD YANI KOTA METRO TAHUN 2022. Diploma thesis, Poltekkes Tanjungkarang.

PARAMITA, EPI (2021) ASUHAN KEPERAWATAN GANGGUAN PEMENUHAN KEBUTUHAN NUTRISI: KESIAPAN PENINGKATAN NUTRISI PADA KELUARGA BAPAK A KHUSUSNYA IBU AY HAMIL TRIMESTER 1 DENGAN TAHAP CHILBEARING DI DESA PENUMANGAN BARU TULANG BAWANG BARAT TAHUN 2021. Diploma thesis, Poltekkes Tanjungkarang.

PARAMITA.S, YESICA (2023) ASUHAN KEPERAWATAN GAWAT DARURAT GANGGUAN KEBUTUHAN OKSIGENASI PADA TN.S DENGAN KASUS PNEUMONIA DI INSTALASI GAWAT DARURAT RSU HANDAYANI KOTABUMI TANGGAL 26 NOVEMBER 2022. Diploma thesis, Poltekkes Kemenkes Tanjungkarang.

PARAMITHA, SONIA (2023) PENGARUH PEMBERIAN TERAPI MUSIK MOZART TERHADAP PENURUNAN SKALA NYERI PADA PASIEN POST OPERASI LAPARATOMI DIRSUD.DR.H.ABDUL MOELOEK PROVINSI LAMPUNG TAHUN 2023. Diploma thesis, Poltekkes KemenkesTanjungkarang.

PARIDA, RIDA’INATUL (2022) ASUHAN KEPERAWATAN GANGGUAN PEMENUHAN KEBUTUHAN OKSIGENASI PADA PASIEN TUBERKULOSIS DI RUANG PARU RSUD. A. DADI. TJOKRODIPO KOTA BANDAR LAMPUNG TAHUN 2022. Diploma thesis, Poltekkes Tanjungkarang.

PARWATI, EVAMIA INDAH (2022) ASUHAN KEPERAWATAN GANGGUAN KEBUTUHAN AKTIVITAS (MOBILITAS FISIK) PADA PASIEN STROKE NON HEMOROGIK DI RUANG SYARAF RSUD JENDERAL AHMAD YANI KOTA METRO TAHUN 2022. Diploma thesis, Poltekkes Tanjungkarang.

PEBRIANI, MIA (2022) ASUHAN KEPERAWATAN PERIOPERATIF PADA PASIEN HERNIA INGUINALIS LATERALIS DENGAN TINDAKAN HERNIOTOMI DI RSUD AHMAD YANI METRO TAHUN 2022. Diploma thesis, Poltekkes Tanjungkarang.

PERMANA, RACHMAT GRIYA (2022) ASUHAN KEPERAWATAN GANGGUAN KEBUTUHAN AKTIVITAS DAN ISTIRAHAT PADA PASIEN CONGESTIVE HEART FAILURE (CHF) DI RUANG JANTUNG RSUD JENDRAL AHMAD YANI KOTA METRO PROVINSI LAMPUNG TAHUN 2022. Diploma thesis, Poltekkes Tanjungkarang.

PERMATA, DESTIA (2022) ASUHANKEPERAWATANGANGGUANKEBUTUHAN AMAN NYAMAN(NYERI)PADAPASIENDISPEPSIA DIRUMAH SAKIT BHAYANGKARA POLDALAMPUNG TAHUN2022. Diploma thesis, Poltekkes Tanjungkarang.

PERSADA, VERA ROSA (2023) ASUHAN KEPERAWATAN DENGAN GANGGUAN OKSIGENASI PADA KASUS PNEUMONIA TERHADAP TN. S DI RUANG FREESIA RS HANDAYANI KOTABUMI LAMPUNG UTARA TANGGAL 14-16 NOVEMBER 2022. Diploma thesis, Poltekkes Kemenkes Tanjungkarang.

PERTIWI, OKTIA HANI (2023) ASUHAN KEPERAWATAN PADA PASIEN POST DEBRIDEMEN ULKUS DIABETIKUM DENGAN MASALAH KEPERAWATAN NYERI AKUT DI RSUD AHMAD YANI KOTA METRO TAHUN 2023. Diploma thesis, Poltekkes Kemenkes Tanjungkarang.

PERTIWI, OKTIA HANI (2022) HUBUNGAN DUKUNGAN KELUARGA DENGAN PENERAPAN MOBILISASI DINI PADA PASIEN POST OPERASI SECTIO CAESAREA DI RSIA ANUGERAH MEDICAL CENTRE KOTA METRO TAHUN 2022. Diploma thesis, Poltekkes Tanjungkarang.

PIRLINA, MUSTIKA (2021) ASUHAN KEPERAWATAN GANGGUAN TERMOREGULASI PADA,ANAK D DENGAN TYPHOID ABDOMINALIS, KELUARGA BAPAK KDI WILAYAH MEKARSARI, KECAMATAN LOMBOK SEMINUNG,KABUPATENLAMPUNG BARAT TAHUN2021. Diploma thesis, Poltekkes Tanjungkarang.

PIRMANDA SR, REPKA (2023) ASUHAN KEPERAWATAN GANGGUAN KEBUTUHAN RASA NYAMAN PADA KLIEN HIPERTENSI DI DUSUN SRIMULYO 1 DESA PEMANGGILAN KECAMATAN NATAR KABUPATEN LAMPUNG SELATAN TAHUN 2023. Diploma thesis, Poltekkes KemenkesTanjungkarang.

PRABOWATI, NI PUTU VIVI (2022) ASUHAN KEPERAWATAN PERIOPERATIF PADA PASIEN DENGAN DIAGNOSA MEDIS KATARAK MATURE OPTIK DEXTRA DENGAN TINDAKAN OPERASI ECCE (EXTRA CAPSULAR CATARACT EXTRACTION) DI RUMAH SAKIT YUKUM MEDICAL CENTRE TAHUN 2022. Diploma thesis, Poltekkes Tanjungkarang.

PRAMESTI, MELA (2021) ASUHAN KEPERAWATAN KELUARGA Tn. S DENGAN GANGGUAN KEBUTUHAN OKSIGENASI : POLA NAFAS TIDAK EFEKTIF PADA TUBERKULOSIS PARU KHUSUSNYA Tn. S DI WILAYAH KERJA PUSKEMAS PALAPA BANDAR LAMPUNG TAHUN 2021. Diploma thesis, Poltekkes Tanjungkarang.

PRAMUDITA, HERLINDA AYU (2023) ASUHAN KEPERAWATAN DENGAN GANGGUAN KEBUTUHAN CAIRAN DAN ELEKTROLIT PADA KASUS CKD TERHADAP TN. R DI RUANG PENYAKIT DALAM A RSUD JENDRAL AHMAD YANI METRO TANGGAL 31 OKTOBER-05 NOVEMBER 2022. Diploma thesis, Poltekkes Kemenkes Tanjungkarang.

PRAMUTSU, ARYA TEJA (2023) ASUHAN KEPERAWATAN DENGAN GANGGUAN KEBUTUHAN OKSIGENASI PADA KASUS CEDERA KEPALA BERAT TERHADAP TN. A DI RUANG INSTALASI GAWAT DARURAT RSUD JENDRAL AHMAD YANI METRO LAMPUNG TANGGAL 08 NOVEMBER 2022. Diploma thesis, Poltekkes Kemenkes Tanjungkarang.

PRANCISKA, SELLA (2021) ASUHAN KEPERAWATAN GAWAT DARURAT PASIEN DENGAN GANGGUAN OKSIGENASI PADAKASUS CIDERA KEPALA SEDANG TERHADAP TN.GDIRUANG IGD RSUD JEND AHMAD YANI METRO TANGGAL 02 APRIL 2021. Diploma thesis, Poltekkes Tanjungkarang.

PRASETIA, MUHAMAD AGUNG (2023) ASUHAN KEPERAWATAN GANGGUAN INTEGRITAS JARINGAN PADA PASIEN ULKUSDIABETIKUM POST DEBRIDEMENTDENGAN INTERVENSIPERAWATAN LUKAMOISTWOUND HEALINGDI RUMAH SAKITMARDIWALUYOKOTA METROTAHUN 2023. Diploma thesis, Poltekkes Kemenkes Tanjungkarang.

PRATAMA, JESTICA PUTRI (2022) ASUHAN KEPERAWATAN GANGGUAN KEBUTUHAN KEAMANAN DAN PROTEKSI PADA PASIEN DENGUE HEMORAGIC FEVER DI RUMAH SAKIT TK. IV 02.07.04 DENKESYAH 02.04.03 BANDAR LAMPUNG TAHUN 2022. Diploma thesis, Poltekkes Tanjungkarang.

PRATAMA, PETRUS ADI (2021) GAMBARAN KADAR ASAM URAT PADA PASIEN USIA PRODUKTIF DI RSUD KABUPATEN PRINGSEWU TAHUN 2019-2020. Diploma thesis, Poltekkes Tanjungkarang.

PRATAMA, REGI (2023) ASUHAN KEPERAWATAN ANAK DENGAN GANGGUAN TERMOREGULASI PADA KASUS FEBRIS TERHADAP An.A DI RUANG EDELWEIS RSU HANDAYANI KOTABUMI LAMPUNG UTARA TANGGAL 22-25 Maret 2023. Diploma thesis, Poltekkes Kemenkes Tanjungkarang.

PRATAMA, RIZKI DEDY (2020) ASUHAN KEPERAWATAN PERIOPERATIF PADA PASIEN HEMOROID DENGAN TINDAKAN HEMOROIDEKTOMY DI RUANG OPERASI RUMAH SAKIT AIRAN RAYA TAHUN 2020. Diploma thesis, Poltekkes Tanjungkarang.

PRATAMA, SURYA (2020) ASUHAN KEPERAWATAN PERIOPERATIF PADA PASIEN OSTEOARTHRITIS DENGAN TINDAKAN TOTAL KNEE REPLACEMENT DI RSUD AHMAD YANI METRO TAHUN 2020. Diploma thesis, Poltekkes Tanjungkarang.

PRATAMA, WAHYU (2021) ASUHAN KEPERAWATAN PERIOPERATIVE PADA PASIEN DENGAN OPERASI HERNIA INGUINALIS DENGAN TINDAKAN OPERASI HERNIAREPAIR DI RUMAH SAKIT ALIMUDIN UMAR LAMPUNG BARAT TAHUN 2021. Diploma thesis, Poltekkes Tanjungkarang.

PRATAMA, WAHYU (2020) PENGARUH PEMBERIAN EYE MASK DAN EARPLUGS TERHADAP KEBUTUHAN PEMENUHAN ISTIRAHAT TIDUR PADA PASIEN POST OPERASI LAPARATOMI DI RUANG RAWAT INAP BEDAH RSUD Dr. H. ABDUL MOELOEK PROVINSI LAMPUNG TAHUN 2020. Diploma thesis, Poltekkes Tanjungkarang.

PRATAMA, WAHYU AGUNG (2023) ASUHAN KEPERAWATAN GANGGUAN OKSIGENASI PADA KASUS TB PARU TERHADAP NY. H DI RUANG PARU RSD. MYJEND HM. RYACUDU KOTABUMI LAMPUNG UTARA 10 – 12 NOVEMBER 2022. Diploma thesis, Poltekkes Kemenkes Tanjungkarang.

PRATAMA, YOGA ERIXKA (2020) ASUHAN KEPERAWATAN GANGGUAN PEMENUHAN KEBUTUHAN PERSONAL HYGIENE PADA KLIEN DEMENSIA DI UPTD PSLU TRESNA WERDHA NATAR KABUPATEN LAMPUNG SELATAN TAHUN 2020. Diploma thesis, Poltekkes Tanjungkarang.

PRATIWI, ANGGUN (2021) ASUHAN KEPERAWATAN DENGAN GANGGUAN OKSIGENASI PADA KASUS STROKE NON HEMORAGIK TERHADAP NY. S DIRUANG SYARAF RSUD MAYJEND HM RYACUDU KOTABUMI LAMPUNG UTARA TANGGAL 08-10 MARET 2021. Diploma thesis, Poltekkes Tanjungkarang.

PRATIWI, FRESY ROSIKA (2020) ASUHAN KEPERAWATAN GANGGUAN PEMENUHAN KEBUTUHAN RASA NYAMAN NYERI PADA KELUARGA DENGAN HIPERTENSIDI PUSKESMAS NATAR LAMPUNG SELATAN TAHUN 2020. Diploma thesis, Poltekkes Tanjungkarang.

PRATIWI, RAHMALIA AYU (2022) ASUHAN KEPERAWATAN PERIOPERATIF PADA PASIEN BENIGNA PROSTAT HIPERPLASIA DENGAN TINDAKAN OPEN PROSTATECTOMY DI RUMAH SAKIT MARDI WALUYO METRO TAHUN 2022. Diploma thesis, Poltekkes Tanjungkarang.

PRATIWI, ZELLIA PUTRI HASTI (2020) ASUHAN KEPERAWATAN GANGGUAN KEBUTUHAN RASA NYAMAN NYERI PADA KLIENRHEUMATOID ARTHRITIS DI UPTD PSLU TRESNA WERDHA NATAR KABUPATEN LAMPUNG SELATAN TAHUN 2020. Diploma thesis, Poltekkes Tanjungkarang.

PRAYOGA, ILYAS INDRA (2023) PENERAPAN RELAKSASI TERHADAP PEMENUHAN KEBUTUHAN RASA NYAMAN PADA PASIEN HIPERTENSI DI RS BHAYANGKARA POLDA LAMPUNG TAHUN 2023. Diploma thesis, Poltekkes KemenkesTanjungkarang.

PRESTESIA, PUJI ANEREF YUNI (2022) ASUHAN KEPERAWATAN PERIOPERATIF PADA PASIEN URETROLITHIASIS DENGAN TINDAKAN (URETEROSCOPIC LITHOTRIPSY) URS DI RUMAH SAKIT YUKUM MEDICAL CENTER LAMPUNG TENGAH TAHUN 2022. Diploma thesis, Poltekkes Tanjungkarang.

PRIHATINI, AYU DWI (2023) ASUHAN KEPERAWATAN GANGGUAN PEMENUHAN KEBUTUHAN OKSIGENASI PADA PASIEN PNEUMONIA DI RUANG PARU RSUD A DADI TJOKRODIPO TAHUN 2023. Diploma thesis, Poltekkes KemenkesTanjungkarang.

PRISTIWANTI, RIZKI MEI (2022) ASUHAN KEPERAWATAN GANGGUAN KEBUTUHAN OKSIGENASI PADA PASIEN TUBERKULOSIS PARU DI RUANG PARU RSUD. A. DADI. TJOKRODIPO KOTA BANDAR LAMPUNG TAHUN 2022. Diploma thesis, Poltekkes Tanjungkarang.

PRITHAYANI, KOMANG (2020) ASUHAN KEPERAWATAN DENGAN GANGGUAN PEMENUHAN KEBUTUHAN KEAMANAN DAN PERLINDUNGAN PADA KLIEN DIABETES MELLITUS DI RUANG KENANGA RSUD Dr. H. ABDUL MOELOEK PROVINSI LAMPUNG TAHUN 2020. Diploma thesis, Poltekkes Tanjungkarang.

PULUNGAN, SYIFA DEVADA PUTRI (2022) ASUHAN KEPERAWATAN GANGGUAN KEBUTUHAN OKSIGENASI PADA PASIEN LEUKEMIA DI RSUD JENDERAL AHMAD YANI METRO PROVINSI LAMPUNG TAHUN 2022. Diploma thesis, Poltekkes Tanjungkarang.

PURWANINGSIH, YENI (2023) ASUHAN KEPERAWATAN GANGGUAN KEBUTUHAN NYERI DAN KENYAMANAN PADA PASIEN POST PARTUM SECTIO CAESAREA DENGAN RESIKO HIPOTENSI DI RSUD Dr. H ABDUL MOELOEK PROVINSI LAMPUNG TAHUN 2023. Diploma thesis, Poltekkes KemenkesTanjungkarang.

PURWATI, KUKUH (2022) ASUHAN KEPERAWATAN GANGGUAN KEBUTUHAN AMAN NYAMAN PADA PASIEN ULKUS DIABETES MELITUS PEDIS SINISTRA DI RUANG BEDAH RSUD JENDERAL AHMAD YANI METRO TAHUN 2022. Diploma thesis, Poltekkes Tanjungkarang.

PUSPITA, ADELIA (2020) ASUHAN KEPERAWATAN GANGGUAN PEMENUHAN KEBUTUHAN PSIKOSOSIAL: HALUSINASI PADA KLIEN SKIZOFRENIA DI RUMAH PENITIPAN PASIEN GANGGUAN JIWA AULIA RAHMA BANDAR LAMPUNG TAHUN 2020. Diploma thesis, Poltekkes Tanjungkarang.

PUSPITA, DELLA (2023) PERBEDAAN PENGARUH AROMATERAPI LAVENDER TERHADAP PENURUNAN TINGKAT NYERI PADA PASIEN PRIA DAN WANITA POST OPERASI LAPARATOMI DI RSUD Dr. H. ABDUL MOELOEK TAHUN 2023. Diploma thesis, Poltekkes Kemenkes Tanjungkarang.

PUSPITA, TIARA (2023) ASUHAN KEPERAWATAN GANGGUAN KEBUTUHAN FISIOLOGIS: NEUROSENSORI PADA KLIEN DEMENSIA DI DUSUN SRIMULYO DESA PEMANGGILAN NATAR KABUPATEN LAMPUNG SELATAN TAHUN 2023. Diploma thesis, Poltekkes KemenkesTanjungkarang.

PUSPITANINGRUM, AMBAR (2023) PENGARUH TEKNIK RELAKSASI NAFAS DALAM TERHADAP KEJADIAN POSTOPERATIVE NAUSEA AND VOMITING (PONV) PADA PASIEN POST OPERASI DENGAN SPINAL ANESTESI DI RSUD Dr. H. ABDUL MOELOEK PROVINSI LAMPUNG TAHUN 2023. Diploma thesis, Poltekkes KemenkesTanjungkarang.

PUSPITARINI, RIZKA DWI (2020) ASUHAN KEPERAWATAN PERIOPERATIF PADA PASIEN KANKER MAMAE DENGAN TINDAKAN EKSISI DI RUANG OPERASI RUMAH SAKIT DKT BANDAR LAMPUNG TAHUN 2020. Diploma thesis, Poltekkes Tanjungkarang.

PUSPITASARI, DIAN (2020) ASUHAN KEPERAWATAN PERIOPERATIF PADA PASIEN UROLITHIASIS DENGAN TINDAKAN URETEROSCOPY DAN LITHOTRIPSY DI RUANG OPERASI RUMAH SAKIT PERTAMINA BINTANG AMIN BANDAR LAMPUNG TAHUN 2020. Diploma thesis, Poltekkes Tanjungkarang.

PUSPITASARI, NILUH AYU (2020) ASUHAN KEPERAWATAN GANGGUAN PEMENUHAN KEBUTUHAN BELAJAR PADA KELUARGA TENTANG BAHAYA GADGET PADA ANAK DI WILAYAH KERJA PUSKESMAS NATAR LAMPUNG SELATAN TAHUN 2020. Diploma thesis, Poltekkes Tanjungkarang.

PUSPITASARI, SHELVIA (2023) HUBUNGAN LAMANYA PENGGUNAAN WAKTU TINDAKAN KEPERAWATAN DENGAN PERSEPSI NYERI PASIEN POST OPERASI DI RSUD JEND AHMAD YANI METRO PROVINSI LAMPUNG. Diploma thesis, Poltekkes Kemenkes Tanjungkarang.

PUSPITASARI, TRIAS (2023) ASUHAN KEPERAWATAN DENGAN GANGGUAN KEBUTUHAN AKTIVITAS DAN ISTIRAHAT PADA KASUS STROKE NON HAEMORAGIC TERHADAP TN. S DI RUANG PENYAKIT DALAM RUMAH SAKIT DAERAH H.M RYACUDU KOTABUMI LAMPUNG UTARA TANGGAL 15-17 NOVEMBER TAHUN 2022. Diploma thesis, Poltekkes Kemenkes Tanjungkarang.

PUTRA, ALDO ANGGA (2023) HUBUNGAN USIA DAN INDEKS MASSA TUBUH DENGAN KEJADIAN HIPOTENSI POST ANESTESI SPINAL PADA PASIEN SECTIO CAESAREA DI RSIA ANUGERAH MEDICAL CENTER KOTA METROTAHUN 2023. Diploma thesis, Poltekkes Kemenkes Tanjungkarang.

PUTRA, HAFIF FATANA (2020) ASUHAN KEPERAWATAN GANGGUAN PEMENUHAN KEBUTUHAN MOBILITAS FISIK PADA LANSIA RHEUMATOID ARTHRITIS DI UPTD PSLU TRESNA WERDHA NATAR LAMPUNG SELATAN. Diploma thesis, Poltekkes Tanjungkarang.

PUTRI, ADELIA (2022) ASUHAN KEPERAWATAN PERIOPERATIF PASIEN DENGAN DIAGNOSA FRAKTUR TIBIA FIBULA + VULNUS SCLOPETORUM DENGAN TINDAKAN OPERASI ORIF (OPEN REDUCTION INTERNAL FIXATION) DI RUANG OPERASI RUMAH SAKIT BHAYANGKARA TK III POLDA LAMPUNG TAHUN 2022. Diploma thesis, Poltekkes Tanjungkarang.

PUTRI, AINI INTAN (2022) ASUHAN KEPERAWATAN GANGGUAN KEBUTUHAN RASA AMAN NYAMAN PADA PASIEN HIPOKALEMIA DI RUANG PENYAKIT DALAM A RSUD. JENDERAL AHMAD YANI KOTA METRO LAMPUNG TAHUN 2022. Diploma thesis, Poltekkes Tanjungkarang.

PUTRI, ALDILA PRISKILLIA (2022) GAMBARAN KADAR KOLESTEROL TOTAL PADA PENGGUNA PIL KB (KAJIAN PUSTAKA). Diploma thesis, Poltekkes Tanjungkarang.

PUTRI, ALVIRA NABILA (2023) ASUHAN KEPERAWATAN NYERI AKUT PADA PASIEN FRAKTUR POST OPERASI ORIF(OPEN REDUCTION INTERNAL FIXATION) DI RUMAH SAKIT BHAYANGKARA POLDA LAMPUNG. Diploma thesis, Poltekkes Kemenkes Tanjungkarang.

PUTRI, ALVIRA NABILA (2022) PENGARUH PENGGUNAAN BLANKET WARMER TERHADAP SUHU TUBUH PADA PASIEN HIPOTERMIA POST OPERASI SEKSIO SESAREA DENGAN SPINAL ANESTESI DI RECOVERY ROOM INSTALASI BEDAH SENTRAL RSUD Dr. H. ABDUL MOELOEK PROVINSI LAMPUNG. Diploma thesis, Poltekkes Tanjungkarang.

PUTRI, ANISA DWI (2023) ASUHAN KEPERAWATAN DENGAN GANGGUAN KEBUTUHAN OKSIGENASI PADA KASUS CEDERA KEPALA BERAT TERHADAP TN. H DI RUANG IGD RSUD JENDRAL AHMAD YANI METRO TANGGAL 05 NOVEMBER 2022. Diploma thesis, Poltekkes Kemenkes Tanjungkarang.

PUTRI, ANNISA AZZAHRA (2022) ASUHAN KEPERAWATAN GANGGUAN KEBUTUHAN OKSIGENASI PADA PASIEN CHRONIC KIDNEY DISEASE DI RSUD JENDRAL AHMAD YANI KOTA METRO PROVINSI LAMPUNG TAHUN 2022. Diploma thesis, Poltekkes Tanjungkarang.

PUTRI, ANNISA NABILA (2023) ASUHAN KEPERAWATAN GANGGUAN KEBUTUHAN OKSIGENASI PADA PASIEN CONGESTIVE HEART FAILURE (CHF) DIRUANG TULIP RSUD Dr. H. ABDUL MOELOEK PROVINSI LAMPUNG TAHUN 2023. Diploma thesis, Poltekkes KemenkesTanjungkarang.

PUTRI, CINDI ERIKA (2022) ASUHAN KEPERAWATAN GANGGUAN KEBUTUHAN AKTIVITAS DAN ISTIRAHAT PADA PASIEN STROKE NON-HEMORAGIK DI RUANG SYARAF RSUD.JEND AHMAD YANI KOTA METRO PROVINSI LAMPUNG TAHUN 2022. Diploma thesis, Poltekkes Tanjungkarang.

PUTRI, DIYAH MUTIARA (2021) ASUHAN KEPERAWATAN PASIEN TERHADAP Ny.T DENGAN GANGGUAN OKSIGENASI PADA KASUS ASMA DI DESA TANJUNG AMAN KEC. KOTABUMI SELATAN KABUPATEN LAMPUNG UTARA 22-25 MARET 2021. Diploma thesis, Poltekkes Tanjungkarang.

PUTRI, DWI PUTRI (2022) ASUHAN KEPERAWATAN PERIOPERATIF PADA PASIEN SELULITIS PEDIS DAN DIABETES MELLITUS TIPE II DENGAN TINDAKAN DEBRIDEMENT DI RSUD JENDRAL AHMAD YANI METRO TAHUN 2022. Diploma thesis, Poltekkes Tanjungkarang.

PUTRI, HANA ELSI (2023) ASUHAN KEPERAWATAN GAWAT DARURAT DENGAN GANGGUAN OKSIGENASI PADA KASUS POST OP KRANIOTOMI e.c INTRACEREBRAL HEMORRHAGE TERHADAP Ny. S DI RUANGAN ICU RSUD JENDRAL AHMAD YANI KOTA METRO TANGGAL 08 – 09 NOVEMER 2022. Diploma thesis, Poltekkes Kemenkes Tanjungkarang.

PUTRI, IIS ELINDA (2023) ASUHAN KEPERAWATAN GANGGUAN OKSIGENASI PADA PENYAKIT PARU OBSTRUKTIF KRONIK (PPOK) TERHADAP NY. J DI INSTALASI GAWAT DAURAT RSU HANDAYANI KOTABUMI LAMPUNG UTARA TANGGAL 24 NOVEMBER 2022. Diploma thesis, Poltekkes Kemenkes Tanjungkarang.

PUTRI, INTAN AGUSTIA (2022) ASUHAN KEPERAWATAN PASIEN DENGAN GANGGUAN TERMOREGULASI PADA KASUS OBSERVASI FEBRIS TERHADAP An. A DI WILAYAH KERJA PUSKESMAS KOTABUMI 2 LAMPUNG UTARA, TANGGAL 07-09 MARET 2022. Diploma thesis, Poltekkes Tanjungkarang.

PUTRI, IRNA ROCHA NOPIYA (2020) ASUHAN KEPERAWATAN GANGGUAN PEMENUHAN KEBUTUHAN AKTIVITAS DAN ISTIRAHAT PADA PASIEN STROKE NON HEMORAGIK DIRUANG SYARAF RSUD JEND. AHMAD YANI METRO PROVINSI LAMPUNG TAHUN 2020. Diploma thesis, Poltekkes Tanjungkarang.

PUTRI, KADEK SHINTA (2022) ASUHANKEPERAWATANGANGGUANKEBUTUHANNYERI DAN KENYAMANAN PADA PASIEN POST OPFRAKTURRADIUSULNADEXTRA DI RUMAH SAKITTK IV 02.07.04DENKESYAH02.04.03 BANDAR LAMPUNGTAHUN2022. Diploma thesis, Poltekkes Tanjungkarang.

PUTRI, KHOLIFATUL ANNISA (2020) ASUHAN KEPERAWATAN GANGGUAN KEBUTUHAN AKTIVITAS DAN ISTIRAHAT PADA PASIEN CONGESTIVE HEART FAILURE DI RUANG RPD RSUD SUKADANALAMPUNG TIMUR TAHUN 2020. Diploma thesis, Poltekkes Tanjungkarang.

PUTRI, LENY ATIKA (2021) ASUHAN KEPERAWATAN DENGAN GANGGUAN RASA AMAN NYAMAN PADA KASUS POST OP ABSES MANDIBULA TERHADAP Ny.S DI RUANG 305 LANTAI 3 RSU HANDAYANI KOTABUMI LAMPUNG UTARA TANGGAL 09-11 MARET 2021. Diploma thesis, Poltekkes Tanjungkarang.

PUTRI, LISDA MEYZA (2020) ASUHAN KEPERAWATAN GANGGUAN MOBILITAS FISIK PADA PASIEN FRAKTUR FEMUR DI RUANG BEDAH RSUD JENDRAL AHMAD YANI METRO PROVINSI LAMPUNG TAHUN 2020. Diploma thesis, Poltekkes Tanjungkarang.

PUTRI, LISDA MEYZA (2020) ASUHAN KEPERAWATAN GANGGUAN MOBILITAS FISIK PADA PASIEN FRAKTUR FEMUR DI RUANG BEDAH RSUD JENDRAL AHMAD YANI METRO PROVINSI LAMPUNG TAHUN 2020. Diploma thesis, Poltekkes Tanjungkarang.

PUTRI, MADE AYU WIDIA (2022) ASUHAN KEPERAWATAN GANGGUAN KEBUTUHAN OKSIGENASI PADA PASIEN DENGAN CONGESTIVE HEART FAILURE (CHF) DI RSUD JENDERAL AHMAD YANI KOTA METRO TAHUN 2022. Diploma thesis, Poltekkes Tanjungkarang.

PUTRI, MEYLANI ANITA (2022) ASUHAN KEPERAWATAN PERIOPERATIF PADA PASIEN KISTA OVARIUM DENGAN TINDAKAN KISTEKTOMI LAPARATOMI DIRUANG OPERASI RS MARDI WALUYO KOTA METRO TAHUN 2020. Diploma thesis, Poltekkes Tanjungkarang.

PUTRI, MIRNA KEMALA (2022) ASUHAN KEPERAWATAN PASIEN DENGAN GANGGUANKEBUTUHAN AKTIVITAS PADA KASUSPOST SECTIOCAESAREATERHADAPNy. S DI RUANG KEBIDANANRSU HANDAYANIKOTABUMI LAMPUNG UTARATANGGAL 07-09 MARET 2022. Diploma thesis, Poltekkes Tanjungkarang.

PUTRI, NABILA AMANDA (2023) PENGARUH EDUKASI MENGGUNAKAN MEDIA BOOKLET DAN AUDIO VISUAL TERHADAP KEMAMPUAN MOBILISASI DINI PASIEN POST OPERASI LAPARATOMI DI RSUD Dr. H. ABDUL MOELOEK PROVINSI LAMPUNG TAHUN 2023. Diploma thesis, Poltekkes Kemenkes Tanjungkarang.

PUTRI, NATSYA ZHAFIRA AJRINA (2021) ASUHAN KEPERAWATAN GANGGUAN KEBUTUHAN NUTRISI DENGAN RISIKO DEFISIT NUTRISI PADA KELUARGA BAPAK D KHUSUSNYA PADA ANAK A DI BATU KERAMAT TANGGAMUS TAHUN 2021. Diploma thesis, Poltekkes Tanjungkarang.

PUTRI, OKTA DIANA (2022) ASUHAN KEPERAWATAN GANGGUAN PEMENUHAN KEBUTUHAN PERSONAL HYGIENE PADA LANSIA DENGAN DEMENSIA DI UPTD PSLU TRESNA WERDHA NATAR KABUPATEN LAMPUNG SELATAN TAHUN 2020. Diploma thesis, Poltekkes Tanjungkarang.

PUTRI, RIZKI AMALIA (2020) ASUHAN KEPERAWATAN KELUARGA LANSIA DENGAN GANGGUAN PEMENUHAN KEBUTUHAN MOBILITAS FISIK PADA LANSIA GOUT ARTHRITIS DI KELURAHAN SEGALAMIDER KECAMATAN TANJUNGKARANG BARAT BANDAR LAMPUNG. Diploma thesis, Poltekkes Tanjungkarang.

PUTRI, ROLA SINTIA (2023) ASUHAN KEPERAWATAN KETIDAKSTABILAN KADAR GLUKOSA DARAH PADA PASIEN DIABETES MELITUS DI RUMAH SAKIT BHAYANGKARA POLDA LAMPUNG TAHUN 2023. Diploma thesis, Poltekkes KemenkesTanjungkarang.

PUTRI, SANIDA APRILIANA (2023) ASUHAN KEPERAWATAN PASIEN DENGAN GANGGUAN OKSIGENASI PADA KASUS PNEUMONIA TERHADAP TN. F DI RUANG VIP C RUMAH SAKIT UMUM DAERAH MAYJEND HM RYACUDU KOTABUMI LAMPUNG UTARA TANGGAL 7-9 NOVEMBER 2022. Diploma thesis, Poltekkes Kemenkes Tanjungkarang.

PUTRI, SISILIA ALDA (2023) ASUHAN KEPERAWATAN DENGAN GANGGUAN TERMOGULASI PADA KASUS KEJANG DEMAM TERHADAP AN. H DI RUANG EDELWEIS RSU HANDAYANI KOTABUMI LAMPUNG UTARA TANGGAL 05-07 APRIL 2023. Diploma thesis, Poltekkes Kemenkes Tanjungkarang.

PUTRI, TIARA SALSABILA EKA (2022) ASUHAN KEPERAWATAN GANGGUAN KEBUTUHAN AKTIVITAS DAN ISTIRAHAT PADA PASIEN ANEMIA DI RUANG KELAS 1 RUMAH SAKIT BHAYANGKARA POLDA LAMPUNG TAHUN 2022. Diploma thesis, Poltekkes Tanjungkarang.

PUTRI, TSARA AFIFAH (2020) ASUHAN KEPERAWATAN GANGGUAN KEBUTUHAN KEAMANAN RESIKO JATUH PADA KLIEN GOUT ARTHRITIS DI UPTD PSLU TRESNA WERDHA NATAR KABUPATEN LAMPUNG SELATAN. Diploma thesis, Poltekkes Tanjungkarang.

PUTRI, UMAYA BUANA (2020) ASUHAN KEPERAWATAN GANGGUAN KEBUTUHAN AKTIVITAS PADA PASIEN FRAKTUR FEMUR DI RUANG GELATIK RSUD Dr. H. ABDULMOELOEK PROVINSI LAMPUNG TAHUN 2020. Diploma thesis, Poltekkes Tanjungkarang.

PUTRI, YOSI NABILA (2023) ASUHAN KEPERAWATAN ANAK DENGAN GANGGUAN OKSIGENASI PADA KASUS ASMA BRONKIAL TERHADAP AN. R DI RUANG EDELWEIS RSU HANDAYANI KOTABUMI LAMPUNG UTARA TANGGAL 20-25 MARET 2023. Diploma thesis, Poltekkes Kemenkes Tanjungkarang.

Pebriyani, Mely (2022) ASUHAN KEPERAWATAN PASIEN DENGAN GANGGGUAN OKSIGENASI PADA KASUS ASMA BRONKIAL TERHADAP NY. T DI RUANG PARU RSD MAYJEND HM RYACUDU KOTABUMI LAMPUNG UTARA TANGGAL 08-11 NOVEMBER 2021. Diploma thesis, Poltekkes Tanjungkarang.

Perdana, Wahyu (2022) ASUHAN KEPERAWATAN JIWA DENGAN GANGGUAN PERSEPSI SENSORI : HALUSINASI PENDENGARAN PADA KASUS SKIZOFRENIA TERHADAP Tn.B RUMAH SAKIT JIWA PROVINSI LAMPUNG TANGGAL 01-05 MARET 2021. Diploma thesis, Poltekkes Tanjungkarang.

Popy Paramita, Paramita Popy (2022) ASUHAN KEPERAWATAN PASIEN DENGAN POST OPERASI DEBRIDEMENT PADA KASUS SNAKE BITETERHADAPAN.S DI RUANG BEDAHRSD. MAYJEND HM. RYACUDU KOTABUMILAMPUNGUTARA 22 s.d24FEBRUARI 2022. Diploma thesis, Poltekkes Tanjungkarang.

Pradila, Armita Dinda (2021) PENATALAKSANAAN ASUHAN GIZI TERSTANDAR PADA PASIEN GAGAL JANTUNG DI RSUD BATIN MANGUNANG KABUPATEN TANGGAMUS TAHUN 2021. Diploma thesis, Poltekkes Tanjungkarang.

Prasetiyo, Muchammad Eko (2022) ASUHAN KEPERAWATAN GAWAT DARURATDENGAN GANGGUANOKSIGENASI PADA KASUS CONGESTIVEHEARTH FAILURE (CHF) TERHADAP Ny. D DI RUANG IGD RSUD JENDRAL AHMAD YANI KOTA METRO TANGGAL 2NOVEMBER 2021. Diploma thesis, Poltekkes Tanjungkarang.

Pratama, Apriyan Fajar (2020) ASUHAN KEPERAWATAN GERONTIK DENGAN GANGGUAN MOBILITAS FISIK PADA KASUS STROKE NON HEMOROGIK TERHADAP NY.N DI WILAYAH KERJA PUSKESMAS KOTABUMI II KABUPATEN LAMPUNG UTARA TANGGAL 30 MARET- 03 APRIL 2020. Diploma thesis, Poltekkes Tanjungkarang.

Pratiwi, Frasiska Putri (2022) ASUHAN KEPERAWATAN DENGAN GANGGUAN AKTIVITAS PADA KASUS STROKE NON HEMORAGIK TERHADAP Tn.S DI RUANG PENYAKIT DALAM RSUD MAYJEND HM RYACUDU KOTABUMI LAMPUNG UTARA TANGGAL 01-03 MARET 2022. Diploma thesis, Poltekkes Tanjungkarang.

Pratiwi, Nadia Eka (2023) ASUHAN KEPERAWATAN KELUARGA DENGAN GANGUAN RASA AMAN DAN NYAMAN PADA KASUS HIPERTENSI TERHADAP TN. C DI DESA ALAM JAYA KABUPATEN LAMPUNG UTARA TANGGAL 11-15 OKTOBER 2022. Diploma thesis, Poltekkes Kemenkes Tanjungkarang.

Pribadi, Teguh and sulastri, sulastri and karlinda, putri (2020) Effectiveness of a cognitive behavioral group therapy program for reducing violence risk in persons with schizophrenia. Diploma thesis, Poltekkes Tanjungkarang.

Pribadi, Teguh and sulastri, sulastri and karlinda, putri (2020) Effectiveness of a cognitive behavioral group therapy program for reducing violence risk in persons with schizophrenia. Diploma thesis, Poltekkes Tanjungkarang.

Purbianto, Purbianto and Agustanti, Dwi (2015) ANALISIS FAKTOR RISIKO GAGAL JANTUNG DI RSUD dr. H. ABDUL MOELOEK PROVINSI LAMPUNG. Diploma thesis, Poltekkes Tanjungkarang.

Purbianto, Purbianto and Agustanti, Dwi (2015) ANALISIS FAKTOR RISIKO GAGAL JANTUNG DI RSUD dr. H. ABDUL MOELOEK PROVINSI LAMPUNG. Diploma thesis, Poltekkes Tanjungkarang.

Purbianto, Purbianto and Agustanti, Dwi (2015) ANALYSIS OF THE FACTORSHYPERGLYCEMIA AMONG PATIENTS WITH DIABETES MELLITUSWHOSETAKING ORAL HYPOGLYCEMIA DRUGS (OHD. Diploma thesis, Poltekkes Tanjungkarang.

Purbianto, Purbianto and Agustanti, Dwi (2015) ANALYSIS OF THE FACTORSHYPERGLYCEMIA AMONG PATIENTS WITH DIABETES MELLITUSWHOSETAKING ORAL HYPOGLYCEMIA DRUGS (OHD. Diploma thesis, Poltekkes Tanjungkarang.

Purbianto, Purbianto and Agustanti, Dwi (2015) ANALYSIS OF THE FACTORSHYPERGLYCEMIA AMONG PATIENTS WITH DIABETES MELLITUSWHOSETAKING ORAL HYPOGLYCEMIA DRUGS (OHD). Diploma thesis, Poltekkes Tanjungkarang.

Purbianto, Purbianto and Agustanti, Dwi (2018) Effect of Sensory and Tactile Stimulation to Increase Glasgow Coma Scale (GCS) Score on Stroke Clients who Have Consciousness Disorders at Abdul Moeloek Hospital, Lampung. Diploma thesis, Poltekkes Tanjungkarang.

Purbianto, Purbianto and Agustanti, Dwi (2018) Effect of Sensory and Tactile Stimulation to Increase Glasgow Coma Scale (GCS) Score on Stroke Clients who Have Consciousness Disorders at Abdul Moeloek Hospital, Lampung. Diploma thesis, Poltekkes Tanjungkarang.

Purbianto, Purbianto and Agustanti, Dwi (2018) Effect of Sensory and Tactile Stimulation to Increase Glasgow Coma Scale (GCS) Score on Stroke Clients who Have Consciousness Disorders at Abdul Moeloek Hospital, Lampung. Diploma thesis, Poltekkes Tanjungkarang.

Purbianto, Purbianto and Agustanti, Dwi (2018) Effect of Sensory and Tactile Stimulation to Increase Glasgow Coma Scale (GCS) Score on Stroke Clients who Have Consciousness Disorders at Abdul Moeloek Hospital, Lampung. Diploma thesis, Poltekkes Tanjungkarang.

Purbianto, Purbianto and Agustanti, Dwi (2015) THE RELATIONSHIP BETWEEN SMOKING A WIDE VARIETY OF TYPES WITH HYPERTENSION. Diploma thesis, Poltekkes Tanjungkarang.

Purbianto, Purbianto and Agustanti, Dwi (2015) THE RELATIONSHIP BETWEEN SMOKING A WIDE VARIETY OF TYPES WITH HYPERTENSION. Diploma thesis, Poltekkes Tanjungkarang.

Purbianto, Purbianto and Agustanti, Dwi (2015) THE RELATIONSHIP BETWEEN SMOKING A WIDE VARIETY OF TYPES WITH HYPERTENSION. Diploma thesis, Poltekkes Tanjungkarang.

Putra, Deni (2023) ASUHAN KEPERAWATAN GANGGUAN KEBUTUHAN RASA NYAMAN PADA KLIEN HIPERKOLESTEROLEMIA DALAM KELUARGA DI DUSUN SRIMULYO I DESA PEMANGGILAN KECAMATAN NATAR KABUPATEN LAMPUNG SELATAN TAHUN 2023. Diploma thesis, Poltekkes KemenkesTanjungkarang.

Putri, Almunadiya Intan (2022) PEMBERIAN AIR REBUSAN DAUN BINAHONG TERHADAP PENYEMBUHAN LUKA PERINEUM PADA IBU NIFAS. Diploma thesis, Poltekkes Tanjungkarang.

Putri, Bakti Andini and ANITA, ANITA (2022) LAIK ETIK : Obesitas Sentral terhadap Kadar Gula Darah Postprandial pada Pegawai Laki-Laki Dewasa di Lingkungan Kerja. Diploma thesis, Poltekkes Tanjungkarag.

Putri, Dhea Maya (2022) ASUHAN KEPERAWATAN KELUARGA DENGAN GANGGUAN RASA NYAMAN PADA KASUS SKABIES TERHADAP INDIVIDU An. R DI DESA MULANG MAYA KEC. KOTABUMI SELATAN KAB. LAMPUNG UTARA TANGGAL 21-24 FEBRUARI 2022. Diploma thesis, Poltekkes Tanjungkarang.

Putri, Noventa Silia (2021) Evaluasi Uji Sensitivitas Dan Spesifisitas Metode Widal, Tubex dan Elisa Sebagai Pemeriksaan Laboratorium Untuk Diagnosa Infeksi Tifoid. Diploma thesis, Poltekkes Tanjungkarang.

Putri, Nurul Fajriyah (2022) ASUHAN KEPERAWATAN DENGAN GANGGUAN SIRKULASI PADA KASUS STROKE NON HEMORAGIK TERHADAP NY. S DI RUANG FRESIALANTAI 3RSU HANDAYANI KOTABUMI LAMPUNG UTARA TANGGAL 23-25 NOVEMBER 2021. Diploma thesis, Poltekkes Tanjungkarang.

Putri, Saprida Meta (2022) ASUHAN KEPERAWATAN JIWA DENGAN GANGGUAN PERSEPSISENSORI: HALUSINASI PENDENGARAN PADA KASUS SKIZOFRENIATERHADAP Ny.A DI RUANG MELATI RUMAH SAKIT JIWADAERAH PROVINSI LAMPUNG TANGGAL 15-20 MARET 2021. Diploma thesis, Poltekkes Tanjungkarang.

Putriana, Yeyen and Aliyanto, Warjidin (2021) EFEKTIFITAS THERAPI MUROTTAL TERHADAP POLA TIDUR BAYI BBLR. Diploma thesis, Poltekkes Tanjung Karang.

Putriana, Yeyen and Aliyanto, Warjidin (2018) Efektifitas Perawatan Metode Kangguru (PMK) dan Terapi Murottal terhadap Peningkatan Berat Badan dan Suhu pada Bayi BBLR. Diploma thesis, Poltekkes Tanjungkarang.

Putriana, Yeyen and Aliyanto, Warjidin (2018) Efektifitas Perawatan Metode Kangguru (PMK) dan Terapi Murottal terhadap Peningkatan Berat Badan dan Suhu pada Bayi BBLR. Diploma thesis, Poltekkes Tanjungkarang.

paulina, sari (2021) ASUHAN KEPERAWATAN DENGAN NYERI AKUT PADA KASUS GASTRITIS TERHADAP An. A. DI RUANG ANAK RSUD MAYJEND HM RYACUDU KOTABUMI LAMPUNG UTARA TANGGAL 27-29 MEI 2020. Diploma thesis, Poltekkes tanjungkarang.

putri, intan permata (2021) ASUHAN KEPERAWATAN PASIEN DENGAN GANGGUAN KEBUTUHAN ISTIRAHAT PADA KASUS POST SECTIO CAESAREA TERHADAP NY. D DI RUANG KEBIDANAN RSUD MAYJEND HM RYACUDU KOTABUMI LAMPUNG UTARA TANGGAL 11-13 MARET 2021. Diploma thesis, Poltekkes tanjungkarang.

Q

QOMARIAH, ELYA (2022) PENGARUH AROMATERAPI PEPPERMINT DAN AKUPRESUR P6 TERHADAP NAUSEA VOMITUS PASIEN POST OPERASI DENGAN ANASTESI UMUM DI RSUD Dr. H ABDOEL MOELOEK PROVINSI LAMPUNG. Diploma thesis, Poltekkes Tanjungkarang.

R

RAHAYU, FITRIA (2020) ASUHAN KEPERAWATAN GANGGUAN KEBUTUHAN AKTIVITAS PADA KLIEN DENGAN MASALAH KESEHATAN CONGESTIVE HEART FAILURE DI RSUD JENDRAL AHMAD YANI METRO PROVINSI LAMPUNG TAHUN 2020. Diploma thesis, Poltekkes Tanjungkarang.

RAHAYU, MARGARETA LINDA PUJI (2022) ASUHAN KEPERAWATAN PERIOPERATIF PADA PASIEN BENIGNA PROSTAT HIPERPLASIA DENGAN TINDAKAN TRANSURETHRAL RESECTION PROSTATE (TURP) DI RUMAH SAKIT YUKUM MEDICAL CENTRE TAHUN 2022. Diploma thesis, Poltekkes Tanjungkarang.

RAHAYU, MARGARETA LINDA PUJI (2021) HUBUNGAN KOMUNIKASI PERAWAT DAN DOKTER DENGAN KINERJA PERAWAT PERIOPERATIF DI RUMAH SAKIT YUKUM MEDICAL CENTRE PROVINSI LAMPUNG TAHUN 2021. Diploma thesis, Poltekkes Tanjungkarang.

RAHAYU, PUTRI (2023) ASUHAN KEPERAWATAN GANGGUAN KEBUTUHAN CAIRAN PADA PASIEN PENDARAHAN POSTPARTUM PERVAGINA DI RUANG DELIMA SRUD Dr. H ABDUL MOELOEK PROVINSI LAMPUNG TAHUN 2023. Diploma thesis, Poltekkes KemenkesTanjungkarang.

RAHMA, OCTA SELVIA (2022) ASUHAN KEPERAWATAN GANGGUAN KEBUTUHAN OKSIGENASI PADA PASIEN TUBERKULOSIS PARU DI RUANG PARU RSUD DR. A DADI TJOKRODIPO PROVINSI LAMPUNG TAHUN 2022. Diploma thesis, Poltekkes Tanjungkarang.

RAHMA, THALITA NUR (2020) ASUHAN KEPERAWATAN PERIOPERATIF PADA PASIEN KATARAK DENGAN FAKOEMULSIFIKASI DAN PEMASANGAN LENSA INTRA-OKULER DI RUANG BEDAH RS MARDI WALUYO METRO PROVINSI LAMPUNG TAHUN 2020. Diploma thesis, Poltekkes Tanjungkarang.

RAHMADANI, DESY (2023) ASUHAN KEPERAWATAN POST OPERASI DIABETES MELLITUS DENGAN TINDAKANDEBRIDEMENTDENGAN MASALAH KEPERAWATAN GANGGUAN INTEGRITAS KULIT DI RUMAH SAKIT MARDI WALUYO METRO. Diploma thesis, Poltekkes Kemenkes Tanjungkarang.

RAHMADANI, DESY (2022) HUBUNGAN PENGETAHUAN DENGAN PERILAKU MOBILISASI DINI PADA PASIEN POST OPERASI LAPARATOMI DI RSUD Dr. H. ABDUL MOELOEK PROVINSI LAMPUNG TAHUN 2022. Diploma thesis, Poltekkes Tanjungkarang.

RAHMADHANI, DESTRI WANTI (2020) ASUHAN KEPERAWATAN JIWA DENGAN GANGGUAN PERSEPSI SENSORI: HALUSINASI PENDENGARAN PADA KASUS SKIZOFRENIA TERHADAP Tn. E DI RUANG KUTILANG RUMAH SAKIT JIWA DAERAH PROVINSI LAMPUNG, TANGGAL 25-27 MARET 2019. Diploma thesis, Poltekkes Tanjungkarang.

RAHMADHANI, TRI PANGESTU (2023) PENERAPAN AROMATERAPI LEMON PADA PASIEN POST LAPARATOMIDENGAN MASALAH NYERI AKUT DIRSUDDR.H ABDUL MOELOEK PROVINSILAMPUNG TAHUN2023. Diploma thesis, Poltekkes Kemenkes Tanjungkarang.

RAHMADHANTI, ZHOYA ANISA (2022) ASUHAN KEPERAWATAN GANGGUAN KEBUTUHAN RASANYAMAN (NYERI) PADA PASIEN DIABETES MELITUS DIRUANGRPDBRSUDJENDERALAHMADYANIKOTA METRO LAMPUNG TAHUN2022. Diploma thesis, Poltekkes Tanjungkarang.

RAHMAH, ZAKIA NUR (2023) ASUHAN KEPERAWATAN PASIEN DENGAN GANGGUAN RASA AMAN NYAMAN PADA KASUS POST APENDIKTOMI TERHADAP Ny. L DI RUANG FREESIA LANTAI 4 RUMAH SAKIT UMUM HANDAYANI KOTABUMI LAMPUNG UTARA TANGGAL 7-9 NOVEMBER 2022. Diploma thesis, Poltekkes Kemenkes Tanjungkarang.

RAHMALIA, ANNISA (2023) PENGARUH TEKNIK RELAKSASI DAN TERAPI PIJAT TERHADAP PENURUNAN INTENSITAS NYERI POST SC DI RUMAH SAKIT ANUGERAH MEDICAL CENTER KOTA METRO PROVINSI LAMPUNG TAHUN 2023. Diploma thesis, Poltekkes Kemenkes Tanjungkarang.

RAHMAN, AMRI WIJAYA (2023) PENGARUH TEKNIK RELAKSASI GUIDED IMAGERY TERHADAP KECEMASAN PASIEN PRE OPERASI LAPAROTOMY DI RSUD JENDERAL AHMAD YANI KOTA METRO LAMPUNG TAHUN 2023. Diploma thesis, Poltekkes KemenkesTanjungkarang.

RAHMAN, RISTI ANDILA SARI (2020) ASUHAN KEPERAWATAN DENGAN GANGGUAN PEMENUHAN KEBUTUHAN ISTIRAHAT TIDUR PADA PASIEN TUBERCULOSIS DI RUANG PARU RSUD JEND. A YANI KOTA METRO PROVINSI LAMPUNG TAHUN 2020. Diploma thesis, Poltekkes Tanjungkarang.

RAHMATICA, FARAH DESYA (2023) ASUHAN KEPERAWATAN DENGAN GANGGUAN KEBUTUHAN RASA NYERI DAN KENYAMANAN PADA PASIEN ASAM URAT DI DESA PEMANGGILAN NATAR LAMPUNG SELATAN TAHUN 2023. Diploma thesis, Poltekkes KemenkesTanjungkarang.

RAHMAWATI, DESI (2021) ASUHAN KEPERAWATAN MATERNITAS PASIEN DENGAN GANGGUAN KEBUTUHAN RASA NYAMAN PADA KASUS POST OPERASI SECTIO CAESAREA TERHADAP Ny. N DI RUANG KEBIDANANRSU HANDAYANI KOTABUMI LAMPUNG UTARA TANGGAL 8-10 MARET 2021. Diploma thesis, Poltekkes Tanjungkarang.

RAHMAWATI, DINA (2023) ASUHAN KEPERAWATAN GANGGUAN KEBUTUHAN AKTIVITAS DAN ISTIRAHAT PADA PASIEN CONGESTIVE HEART FAILURE DI RUANG JANTUNG RSUD Dr. H. ABDUL MOELOEK PROVINSI LAMPUNG TAHUN 2023. Diploma thesis, Poltekkes KemenkesTanjungkarang.

RAHMAWATI, ENI (2022) ASUHAN KEPERAWATAN GANGGUAN KEBUTUHAN RESPIRASI PADA PENYAKIT PARU OBSTRUKSI KRONIK (PPOK) DI RUANG ICU RS BHAYANGKARA POLDA LAMPUNG PROVINSI LAMPUNG TAHUN 2022. Diploma thesis, Poltekkes Tanjungkarang.

RAHMAWATI, LIA (2022) ASUHAN KEPERAWATAN GANGGUAN PEMENUHAN KEBUTUHAN RASA NYAMAN (NYERI) PADA PASIEN POST OPERASI FRAKTUR RADIUS ULNA DI RUMAH SAKIT BHAYANGKARA POLDA LAMPUNG TAHUN 2022. Diploma thesis, Poltekkes Tanjungkarang.

RAHMAWATI, NOVI (2021) ASUHAN KEPERAWATAN PERIOPERATIF PADA PASIEN HEMOROID DENGAN TINDAKAN HEMOROIDEKTOMI DI RUANG INSTALASI BEDAH SENTRAL RSUD ALIMUDIN UMAR LAMPUNG BARAT TAHUN 2021. Diploma thesis, Poltekkes Tanjungkarang.

RAHMAWATI, NOVI (2020) PENGARUH TERAPI SLOW STROKE BACK MASSAGE DENGAN VIRGIN COCONUT OIL TERHADAP KUALITAS TIDURPADA PASIEN OPERASI SECTIO CAESAREA DI RSUD Dr. H. ABDOEL MOELOEK PROVINSI LAMPUNG TAHUN 2020. Diploma thesis, Poltekkes Tanjungkarang.

RAHMAWATI, SETIA (2023) PENERAPAN AROMATERAPI LAVENDER PADA PASIEN POST DEBRIDEMENT ULKUS DIABETIKUM DENGAN MASALAH KEPERAWATAN NYERI DI RSUD JENDERAL AHMAD YANI KOTA METRO TAHUN 2023. Diploma thesis, Poltekkes Kemenkes Tanjungkarang.

RAHMAWATI, SETIA (2022) PENGARUH PIJAT OKSITOSIN TERHADAP PENGELUARAN ASI PADA IBU POST OPERASI SECTIO CAESAREA DI RSIA ANUGERAH MEDICAL CENTRE KOTA METRO TAHUN 2022. Diploma thesis, Poltekkes Tanjungkarang.

RAMADHAN, ANISA DWI (2023) ASUHAN KEPERAWATAN PASIEN DENGAN HARGA DIRI RENDAH KRONIS PADA KASUS SKIZOFRENIA TERHADAP Tn. S DI RUANG KUTILANG RUMAH SAKIT JIWA DAERAH PROVINSI LAMPUNG TANGGAL 1-3 MARET 2022. Diploma thesis, Poltekkes Kemenkes Tanjungkarang.

RAMADHAN, ANISA DWI (2023) ASUHAN KEPERAWATAN PASIEN DENGAN HARGA DIRI RENDAH KRONIS PADA KASUS SKIZOFRENIA TERHADAP Tn. S DI RUANG KUTILANG RUMAH SAKIT JIWA DAERAH PROVINSI LAMPUNG TANGGAL 1-3 MARET 2022. Diploma thesis, Poltekkes Kemenkes Tanjungkarang.

RAMADHAN, ANISA DWI (2023) ASUHAN KEPERAWATAN PASIEN DENGAN HARGA DIRI RENDAHKRONIS PADA KASUS SKIZOFRENIA TERHADAP TN.S DI RUANG KUTILANG RUMAH SAKIT JIWA DAERAH PROVINSI LAMPUNG. TANGGAL 1-3 MARET 2022. Diploma thesis, Poltekkes Kemenkes Tanjungkarang.

RAMADHAN, BRILIAN (2022) ASUHAN KEPERAWATAN GANGGUAN KEBUTUHAN RASANYAMAN (NYERI) PADA PASIEN DENGANHIPERTENSIDIRUMAH SAKITBHAYANGKARAPOLDA LAMPUNG TAHUN 2022. Diploma thesis, Poltekkes Tanjungkarang.

RAMADHAN, CHRISNA WAHYU (2023) ASUHAN KEPERAWATAN GANGGUAN INTEGRITASJARINGAN PADA PASIEN ULKUS DIABETIKUMPOSTDEBRIDEMENT DI RSUD JENDRAL AHMADYANIMETRO TAHUN 2023. Diploma thesis, Poltekkes Kemenkes Tanjungkarang.

RAMADHAN, GALUH (2023) ASUHAN KEPERAWATAN PASIEN DENGAN GANGGUAN RASA NYAMAN PADA KASUS POST SECTIO CAESAREA TERHADAP NY. A DI RUANG KEBIDANAN RSU HANDAYANI KOTABUMI LAMPUNG UTARA TANGGAL 27-29 MARET 2023. Diploma thesis, Poltekkes Kemenkes Tanjungkarang.

RAMADHAN, RIZKI (2021) ASUHAN KEPERAWATAN GANGGUAN KEBUTUHAN AKTIVITAS PADA BAPAK S KELUARGA BAPAK S DENGAN STROKE DI DESA TALANG PADANG KECAMATAN TALANG PADANG KABUPATEN TANGGAMUS TAHUN 2021. Diploma thesis, Poltekkes Tanjungkarang.

RAMADHANI, ADINDA NURUL (2021) ASUHAN KEPERAWATAN PASIEN DENGAN GANGGUAN KEBUTUHAN RASA NYAMAN PADA KASUS POST SECTIO CAESAREA TERHADAP Ny.A DI RUANG KEBIDANAN RSU HANDAYANI KOTABUMI LAMPUNG UTARA TANGGAL 08-10 MARET 2021. Diploma thesis, Poltekkes Tanjungkarang.

RAMADHANI, DESY (2022) ASUHAN KEPERAWATAN PERIOPERATIF PADA PASIEN KATARAK DENGAN TINDAKAN FAKOEMULSIFIKASI DI RS. MARDI WALUYO METRO. Diploma thesis, Poltekkes Tanjungkarang.

RAMADHANI, RAMADHANI (2022) ASUHAN KEPERAWATAN PERIOPERATIF PADA PASIEN CLOSED FRACTURE CRURIS DEXTRA DENGAN TINDAKAN ORIF DI RUANG OPERASI RSUD JEND. AHMAD YANI METRO TAHUN 2022. Diploma thesis, Poltekkes Tanjungkarang.

RAMADHANTI, SINTHIA (2021) ASUHAN KEPERAWATAN PERIOPERATIF PADA PASIEN UROLITHIASIS DENGAN TINDAKAN URS (URETEROSCOPIC LITHOTRIPSY) DI RUANG OPERASI RUMAH SAKIT JEND. AHMAD YANI KOTA METRO TAHUN 2021. Diploma thesis, Poltekkes Tanjungkarang.

RAMADHANTI, SINTHIA (2020) PENGARUH FOOT MASSAGE DENGAN LEMON ESSENTIAL OIL TERHADAP PENURUNAN TINGKAT KECEMASAN PADA PASIEN PRE OPERASI DI RUANG BEDAH RSUD ABDUL MOELOEK PROVINSI LAMPUNG TAHUN 2020. Diploma thesis, Poltekkes Tanjungkarang.

RAMADHINI, DELIA FINKA (2022) ASUHAN KEPERAWATAN GANGGUAN KEBUTUHANNUTRISI PADA PASIEN DIABETES MELLITUS DI RUANG CAMARRS BHAYANGKARA POLDA LAMPUNG TAHUN 2022. Diploma thesis, Poltekkes Tanjungkarang.

RAMADHON, RACHMAD (2023) ASUHAN KEPERAWATAN GERONTIK DENGAN GANGGUAN AKTIVITAS DAN ISTIRAHAT PADA KASUS STROKE NON HEMORAGIK TERHADAP TN. M DI DESA TANJUNG HARAPAN WILAYAH KERJA PUSKESMAS KOTABUMI II KABUPATEN LAMPUNG UTARA TANGGAL 18-20 MARET 2023. Diploma thesis, Poltekkes Kemenkes Tanjungkarang.

RANTIKA A.N, FERDARA (2020) ASUHAN KEPERAWATAN DENGAN GANGGUAN KEBUTUHAN AKTIVITAS ISTIRAHAT (TIDUR) PADA PASIEN KANKER DI RUANG MAWAR RSUD dr. H. ABDUL MOELOEK PROVINSI LAMPUNG TAHUN 2020. Diploma thesis, Poltekkes Tanjungkarang.

REFKIAWAN, M. EGI (2023) ASUHAN KEPERAWATAN GANGGUAN KEBUTUHAN KEAMANAN DAN PROTEKSI THERMOGULASI PADA PASIEN DENGUE HEMORAGIC FEVER (DHF) DI RUANG ALAMANDA RSUD Dr. H ABDUL MOELOEK PROVINSI LAMPUNG TAHUN 2023. Diploma thesis, Poltekkes KemenkesTanjungkarang.

REJEKI, SRI (2023) APLIKASI PENATALAKSANAAN HIPOTERMI POST OPERATIF MENGGUNAKAN ALUMINIUM BLANKET DI RUMAH SAKIT UMUM DAERAH ALIMUDDIN UMAR LAMPUNG BARAT TAHUN 2023. Diploma thesis, Poltekkes Kemenkes Tanjungkarang.

RENALDI, NANDA FEBI (2020) ASUHAN KEPERAWATAN GANGGUAN PEMENUHAN KEBUTUHAN MOBILITAS FISIK PADA PASIEN LANSIA DENGAN ARTRITIS REUMATOID DI UPTD PSLU TRESNA WERDHA NATARPROVINSI LAMPUNG TAHUN 2020. Diploma thesis, Poltekkes Tanjungkarang.

RENALDI, RENALDI (2023) ASUHAN KEPERAWATAN KELUARGA DENGAN GANGGUAN AMAN DAN NYAMAN PADA KASUS HIPERTENSI TERHADAP Ny.K DI WILAYAH KERJA PUSKESMAS KOTABUMI II KAB. LAMPUNG UTARA TANGGAL 28-30 MARET 2023. Diploma thesis, Poltekkes Kemenkes Tanjungkarang.

RENI, I IS KOMANG (2020) PENGARUH TERAPI MUSIK KLASIK MOZART TERHADAP PENURUNAN TEKANAN DARAH DAN FREKUENSI DENYUT JANTUNG PASIEN PRE OPERASI DENGAN LITERATURE REVIEW. Diploma thesis, Poltekkes Tanjungkarang.

RENI, I.IS KOMANG (2021) ASUHAN KEPERAWATAN PERIOPERTIF PADA PASIEN HERNIA INGUINALIS DEXTRA DENGAN TINDAKAN HERNIOTOMY DI RUANG OPERASI RUMAH SAKIT BHAYANGKARA POLDA LAMPUNG TAHUN 2021. Diploma thesis, Poltekkes Tanjungkarang.

RENIDA, SERVITA (2020) ASUHAN KEPERAWATAN GANGGUAN KEBUTUHAN OKSIGENASI PADA PASIEN PENYAKIT PARU OBSTRUKTIF KRONIK (PPOK) DI RUANG MELATI RSUD Dr. H. ABDUL MOELOEK PROVINSI LAMPUNG TAHUN 2020. Diploma thesis, Poltekkes Tanjungkarang.

RHEINABILA, RHEINABILA (2023) HUBUNGAN PENGETAHUAN DENGAN MOBILISASI DINI PADA PASIEN POST SECTIO CAESAREA DI RSIA ANUGERAH MEDICAL CENTER KOTA METRO PROVINSI LAMPUNG TAHUN 2023. Diploma thesis, Poltekkes KemenkesTanjungkarang.

RIA, SILA RESTU (2023) HUBUNGAN PENGETAHUAN DAN SIKAP DENGAN PERILAKU DALAM PELAKSANAAN MOBILISASI DINI PADA PASIEN POST OPERASI DI RSUD Dr.H. ABDUL MOELOEK PROVINSI LAMPUNG TAHUN 2023. Diploma thesis, Poltekkes KemenkesTanjungkarang.

RIANI, NADIA (2021) ASUHAN KEPERAWATAN GANGGUAN KEBUTUHAN CAIRAN DAN ELEKTROLIT DENGAN DIARE PADA ANAK USIA PRASEKOLAH KELUARGA BAPAK N KHUSUSNYA ANAK D DI DESA KEJAYAAN KECAMATAN TALANG PADANG TANGGAMUS TAHUN 2021. Diploma thesis, Poltekkes Tanjungkarang.

RIF’AT, RISA RIVITA AR (2022) ASUHAN KEPERAWATAN GANGGUAN KEBUTUHAN CAIRAN DAN ELEKTROLIT PADA PASIEN DENGUE HAEMORRHAGIC FEVER (DHF) DI RUMAH SAKIT BHAYANGKARA POLDA LAMPUNG TAHUN 2022. Diploma thesis, Poltekkes Tanjungkarang.

RINA, NI WAYAN (2021) ASUHAN KEPERAWATAN GANGGUAN RASA AMAN NYAMAN: NYERI AKUTPADA KASUS POST OPERASI KARSINOMA MAMMAE TERHADAP NY. S DI RUANG PENYAKIT DALAM RSUD MAYJEND HM RYACUDU KOTABUMI LAMPUNG UTARA TANGGAL 8-10 MARET 2021. Diploma thesis, Poltekkes Tanjungkarang.

RINDIYANTI, NOVITA (2023) PENGARUH TERAPI SENI TERHADAP PENURUNAN TINGKAT KECEMASAN PADA PASIEN PRE OPERASI DI RSUD JENDRAL AHMAD YANI METRO PROVINSI LAMPUNG TAHUN 2023. Diploma thesis, Poltekkes KemenkesTanjungkarang.

RISTIANA, YENI (2020) ASUHAN KEPERAWATAN GANGGUAN KEBUTUHAN PERSONAL HYGIENE PADA KLIEN STROKE DI UPTD PSLU TRESNA WERDHA NATAR PROVINSI LAMPUNG TAHUN 2020. Diploma thesis, Poltekkes Tanjungkarang.

RIZQIANI, SINTA (2023) FAKTOR-FAKTOR YANG BERHUBUNGAN DENGAN MOBILISASI DINI PADA PASIEN POST OPERASI DI RUANG BEDAH RSUD DR. H. ABDUL MOELOEK PROVINSI LAMPUNG TAHUN 2023. Diploma thesis, Poltekkes Kemenkes Tanjungkarang.

ROFIQ, PRIMA DINAR AINUR (2022) ASUHAN KEPERAWATAN PERIOPERATIF PADA PASIEN FRAKTUR PEDIS DEXTRA DIGIT V DENGAN TINDAKAN OPEN REDUCTION INTERNAL FIXATION DI RUMAH SAKIT MARDI WALUYO METRO TAHUN 2022. Diploma thesis, Poltekkes Tanjungkarang.

ROHMAN, HIDAYAT (2021) ASUHAN KEPERAWATAN GANGGUAN MOBILITAS FISIK PADA BAPAK M KELUARGA BAPAK M DENGAN STROKE NON HEMORAGIK DI DESA BUMI AGUNG KECAMATAN BELALAU KABUPATEN LAMPUNG BARAT TAHUN 2021. Diploma thesis, Poltekkes Tanjungkarang.

ROMADHONA, NIKE (2023) ASUHAN KEPERAWATAN GANGGUAN KEBUTUHAN NUTRISI PADA PASIEN DIABETES MELITUS DI RUANG MELATI RUMAH SAKIT TK IV.02.07.04 KOTA BANDAR LAMPUNG TAHUN 2023. Diploma thesis, Poltekkes KemenkesTanjungkarang.

ROSDIANTIKA, OKTA (2022) ASUHAN KEPERAWATAN PERIOPERATIF PADA PASIEN CHOLELITHIASIS DENGAN TINDAKAN KOLESISTEKTOMI DI RUMAH SAKIT MARDI WALUYO KOTA METRO TAHUN 2022. Diploma thesis, Poltekkes Tanjungkarang.

ROSIANA, DESI (2022) ASUHANKEPERAWATANGANGGUAN KEBUTUHAN AKTIVITAS DAN ISTIRAHAT PADA PASIEN STROKE NON HEMORAGIK DIRUANG SYARAF RSUD JENDERALAHMAD YANI KOTA METRO PROVINSI LAMPUNG TAHUN2022. Diploma thesis, Poltekkes Tanjungkarang.

ROSLIANA, RIZKA YULI (2020) ASUHAN KEPERAWATAN PASIEN DENGAN HIPERTERMIPADA KASUS KEJANG DEMAMTERHADAP An.NDI RUANGANAKRSD MAYJEND HM RYACUDUKOTABUMI LAM PUNG UTARATANGGAL 10-12 MARET 2020. Diploma thesis, Poltekkes Tanjungkarang.

ROZI, FAHRUL (2023) ASUHAN KEPERAWATAN PASIEN DENGAN GANGGUAN PERSEPSI SENSORI : HALUSINASI PENDENGARAN PADA KASUS SKIZOFRENIA PARANOID TERHADAP Tn. B DI RUANGAN NURI RUMAH SAKIT JIWA DAERAH PROVINSI LAMPUNG TANGGAL 7-9 MARET 2022. Diploma thesis, Poltekkes Kemenkes Tanjungkarang.

RUFAIDAH, INDRI (2023) ASUHAN KEPERAWATAN GANGGUAN KEBUTUHAN NYAMAN (NYERI) PADA PASIEN POST OPERASI TUMOR PAYUDARA DI RUANG MAWAR RUMAH SAKIT TK IV 02.07.04 DENKESYAH 02.04.03 BANDAR LAMPUNG TAHUN 2023. Diploma thesis, Poltekkes KemenkesTanjungkarang.

RUSANDI, VERA CAHYATI (2023) ASUHAN KEPERAWATAN GANGGUAN RASA NYAMAN PADA PASIEN POST HEMOROIDEKTOMI DENGAN INTERVENSI KOMPRES DINGIN DI RSUD ABDUL MOELEOK PROVINSI LAMPUNG TAHUN 2023. Diploma thesis, Poltekkes Kemenkes Tanjungkarang.

Rahmadi, Antun and Bertalina, Bertalina and Sudarmi, Sudarmi and Aprina, Aprina (2022) Education on Nutrition, Sanitation, and IYCF to Increase Mother's Knowledge in Lokus Stunting Village. Diploma thesis, Poltekkes Tanjungkarang.

Rahmadi, Antun and Bertalina, Bertalina and Sudarmi, Sudarmi and Aprina, Aprina (2022) Education on Nutrition, Sanitation, and IYCF to Increase Mother's Knowledge in Lokus Stunting Village. Diploma thesis, Poltekkes Tanjungkarang.

Rahmadi, Antun and Bertalina, Bertalina and Sudarmi, Sudarmi and Aprina, Aprina (2022) KORESPONDENSI : Education on Nutrition, Sanitation, and IYCF to Increase Mother's Knowledge in Lokus Stunting Village. Diploma thesis, Poltekkes Tanjungkarag.

Rahmadi, Antun and Bertalina, Bertalina and Sudarmi, Sudarmi and Aprina, Aprina (2022) LAIK ETIK : Education on Nutrition, Sanitation, and IYCF to Increase Mother's Knowledge in Lokus Stunting Village. Diploma thesis, Poltekkes Tanjungkarag.

Rahmadi, Antun and Bertalina, Bertalina and Sudarmi, Sudarmi and Aprina, Aprina (2022) TURNITIN : Education on Nutrition, Sanitation, and IYCF to Increase Mother's Knowledge in Lokus Stunting Village. Diploma thesis, Poltekkes Tanjungkarag.

Rahmadona, Dela (2022) ASUHAN KEPERAWATAN KELUARGA DENGANGANGGUAN NYERI DAN KENYAMANAN PADA KASUS GOUT ARTHRITIS TERHADAP TN. H DI WILAYAHKERJAPUSKESMASKOTABUMI II KABUPATEN LAMPUNG UTARA TANGGAL21-25 FEBRUARI 2022. Diploma thesis, Poltekkes Tanjungkarang.

Rammanda, Ryo (2021) ASUHAN KEPERAWATAN GANGGUAN OKSIGENASI KELUARGA TN. S KHUSUSNYA AN. N DENGAN BERSIHAN JALAN NAFAS TIDAK EFEKTIF PADAISPA DI DESA DADI REJO WONOSOBO TANGGAMUS TAHUN 2021. Diploma thesis, Poltekkes Tanjungkarang.

Rani Gusti Nanda, Nanda Rani Gusti (2022) ASUHAN KEPERAWATAN PASIEN DENGAN GANGGUAN RASA NYAMAN PADA KASUS POST OP TUMOR ABDOMEN TERHADAP Ny. S DI RUANG FREESIARSU HANDAYANI KOTABUMI LAMPUNG UTARA TANGGAL 15-17 MARET 2022. Diploma thesis, Poltekkes Tanjungkarang.

Ridwan, M and Indah lestari, gangsar and Fibrilia, firda (2021) HUBUNGAN USIA IBU, OBESITAS DAN PENGGUNAAN KONTRASEPSI HORMONAL DENGAN KEJADIAN MIOMA UTERI. Diploma thesis, Poltekkes Tanjung Karang.

Rika Melia, Melia Rika (2022) ASUHAN KEPERAWATAN JIWA DENGAN GANGGUAN PERSEPSI SENSORI HALUSINASIPENDENGARAN PADA KASUS SKIZOFRENIA TERHADAP Tn. R DI RUANG KUTILANG RUMAH SAKIT JIWA DAERAH PROVINSI LAMPUNG TANGGAL 1 s.d 6 MARET 2021. Diploma thesis, Poltekkes Tanjungkarang.

Rosalia, Hani (2022) ASUHAN KEPERAWATAN PASIENDENGAN GANGGUAN OKSIGENASI PADA KASUS ASMA BRONCHIAL TERHADAP Ny. E DI RUANG FRESIA LANTAI 3 RSU HANDAYANI KOTABUMI LAMPUNG UTARA TANGGAL 1-6 DESEMBER 2021. Diploma thesis, Poltekkes Tanjungkarang.

Rosalinda, Dhea (2023) ASUHAN KEPERAWATAN GANGGUAN KEBUTUHAN SIRKULASI PADA PASIEN ANEMIA DI RUANG PENYAKIT DALAM NON INFEKSIUS RSUD Dr. H. ABDUL MOELOEK PROVINSI LAMPUNG TAHUN 2023. Diploma thesis, Poltekkes KemenkesTanjungkarang.

Rosmadewi, Rosmadewi and Mugiati, Mugiati and Aliyanto, Warjidin (2018) Risk Factors of Mother Associated to the Event of Premature Birth. Diploma thesis, Poltekkes Tanjungkarang.

Rosmadewi, Rosmadewi and Mugiati, Mugiati and Aliyanto, Warjidin (2018) Risk Factors of Mother Associated to the Event of Premature Birth. Diploma thesis, Poltekkes Tanjungkarang.

Ruliyanto, Ruliyanto (2022) ASUHAN KEPERAWATAN PASIEN DENGAN GANGGUAN KEBUTUHAN CAIRAN PADA KASUS DIARE TERHADAP An. K DI RUANG EDELWEISRUMAH SAKIT UMUM HANDAYANI KOTABUMI LAMPUNG UTARA TANGGAL 28 FEBUARI – 02 MARET 2022. Diploma thesis, Poltekkes Tanjungkarang.

rahayu, rahayu (2021) ASUHAN KEPERAWATAN JIWA GANGGUAN PERSEPSI SENSORI: HALUSINASI PENGLIHATAN PADA KASUS SKIZOFRENIA TERHADAP Ny. P DI WILAYAH KERJA PUSKESMAS KOTABUMI II LAMPUNG UTARA TANGGAL 08-10 MARET 2021. Diploma thesis, Poltekkes tanjungkarang.

rohayati, rohayati and Aprina, Aprina (2021) KORESPONDENSI : Pengaruh Penyuluhan Partisipatif untuk Meningkatkan Pengetahuan Ibu tentang Penerapan Gizi Seimbang dalam Penanggulangan Stunting. Diploma thesis, Poltekkes Tanjungkarag.

rohayati, rohayati and Aprina, Aprina (2021) LAIK ETIK : Pengaruh Penyuluhan Partisipatif untuk Meningkatkan Pengetahuan Ibu tentang Penerapan Gizi Seimbang dalam Penanggulangan Stunting. Diploma thesis, Poltekkes Tanjungkarag.

rohayati, rohayati and Aprina, Aprina (2021) Pengaruh Penyuluhan Partisipatif untuk Meningkatkan Pengetahuan Ibu tentang Penerapan Gizi Seimbang dalam Penanggulangan Stunting. Diploma thesis, Poltekkes Tanjungkarang.

rohayati, rohayati and Aprina, Aprina (2021) Pengaruh Penyuluhan Partisipatif untuk Meningkatkan Pengetahuan Ibu tentang Penerapan Gizi Seimbang dalam Penanggulangan Stunting. Diploma thesis, Poltekkes Tanjungkarang.

rohayati, rohayati and Aprina, Aprina (2021) TURNITIN : Pengaruh Penyuluhan Partisipatif untuk Meningkatkan Pengetahuan Ibu tentang Penerapan Gizi Seimbang dalam Penanggulangan Stunting. Diploma thesis, Poltekkes Tanjungkarag.

ronida, vivilia (2021) ASUHAN KEPERAWATAN PASIEN DENGAN GANGGUAN KEBUTUHAN CAIRAN PADA KASUS POST PARTUM HAEMORRHAGE (PPH) TERHADAP NY. E DI RUANG KEBIDANAN RSUD MAYJEND HM RYACUDU KOTABUMI LAMPUNG UTARA TANGGAL 11-13 MARET 2021. Diploma thesis, Poltekkes tanjungkarang.

S

S, TRIA MAYLIN (2022) ASUHAN KEPERAWATAN GANGGUAN KEBUTUHAN AKTIVITAS DAN ISTIRAHAT PADA PASIEN CONGESTIVE HEART FAILURE DI RUANGJANTUNG RSUD JENDRAL AHMAD YANI KOTA METRO PROVINSI LAMPUNG TAHUN 2022. Diploma thesis, Poltekkes Tanjungkarang.

SABPUTRI, OKTAVIA DWI (2021) ASUHAN KEPERAWATAN KELUARGA TERHADAP Ny.U DENGAN GANGGUAN NUTRISI PADA KASUS DIABETES MELITUS TIPE 2 DI KEL. MARGOTOTO KEC. METRO KIBANG KABUPATEN LAMPUNG TIMUR TANGGAL 22-24 MARET 2021. Diploma thesis, Poltekkes Tanjungkarang.

SABRINA, BERTANIA (2023) ASUHAN KEPERAWATAN ANAK DENGAN GANGGUAN TERMOREGULASI PADA KASUS OBSERVASI FEBRIS TERHADAP AN. D DI RSU HANDAYANI KOTABUMI, KABUPATEN LAMPUNG UTARA TANGGAL 06-08 APRIL 2023. Diploma thesis, Poltekkes Kemenkes Tanjungkarang.

SAFITRI, BELLA (2021) ASUHAN KEPERAWATAN DENGAN GANGGUAN INTERGRIT KULIT/JARINGAN PADA KASUS DIABETES MELITTUS TIPE II TERHADAP Ny.W DI RUANG BEDAH RSD MAYJEND HM RYACUDU KOTABUMI LAMPUNG UTARA TANGGAL 08-10 MARET 2021. Diploma thesis, Poltekkes Tanjungkarang.

SAFITRI, BELNI EKA (2020) ASUHAN KEPERAWATAN DENGAN GANGGUAN MASALAH KEBUTUHAN NUTRISI PADA IBU HAMIL TRIMESTER 1 DI PUSKESMAS RAWAT INAP KEMILING TAHUN 2020. Diploma thesis, Poltekkes Tanjungkarang.

SAFITRI, HESTY ASMA (2021) ASUHAN KEPERAWATAN GANGGUAN PEMENUHAN KEBUTUHAN NYAMAN NYERI PADA LANSIA KELUARGA TN. M DENGAN HIPERTENSI DI DESA SUKADANA DARATKECAMATAN SUKADANA KABUPATEN LAMPUNG TIMUR TAHUN 2021. Diploma thesis, Poltekkes Tanjungkarang.

SAFITRI, LINDA (2021) ASUHAN KEPERAWATAN PERIOPERATIF PADA PASIENUROLITHIASIS DENGAN TINDAKAN URS (URETEROSCOPIC LITHOTRIPSY) DI RUANG OPERASI RUMAH SAKIT YUKUM MEDICAL CENTER LAMPUNG TENGAH TAHUN 2021. Diploma thesis, Poltekkes Tanjungkarang.

SAFITRI, LINDA (2020) PENGARUH TERAPI BLANKET WARMER DAN MUROTTAL AL-QUR’AN TERHADAP WAKTU PULIH SADAR DI RUANG PEMULIHAN INSTALASI BEDAH SENTRAL RSUD Dr.H. ABDUL MOELOEK PROVINSI LAMPUNG TAHUN 2020. Diploma thesis, Poltekkes Tanjungkarang.

SAFITRI, MASNUNI (2020) ASUHAN KEPERAWATAN GANGGUAN KEBUTUHAN OKSIGENASI DENGAN MASALAH POLA NAPAS TIDAK EFEKTIF PADA PASIEN PPOK DI RUANG PARU RSUD JEND. A. YANI KOTA METRO TAHUN 2020. Diploma thesis, Poltekkes Tanjungkarang.

SAFITRI, NIMAS (2023) ASUHAN KEPERAWATAN JIWA DENGAN PEMENUHAN KEBUTUHAN PSIKOSOSIAL GANGGUAN SENSORI PERSEPSI PADA PASIEN SKIZOFRENIA DI RUMAH SAKIT JIWA PROVINSI LAMPUNG TAHUN 2023. Diploma thesis, Poltekkes KemenkesTanjungkarang.

SAFITRI, NOFA (2020) PENGARUH KOMBINASI AKUPRESUR HT 7 DAN AROMATERAPI CENDANA TERHADAP PENURUNAN TINGKAT KECEMASAN PREOPERASI DI RUANG BEDAH RSUD Dr. H. ABDUL MOELOEK PROVINSI LAMPUNG TAHUN 2020. Diploma thesis, Poltekkes Tanjungkarang.

SAFITRI, NOVA (2023) ASUHAN KEPERAWATAN GANGGUAN KEBUTUHAN OKSIGENASI PADA PASIEN TUBERCULOSIS PARU DIRUANG PARU (E1) RSUD Dr. A. DADI TJOKRODIPO LAMPUNG LAMPUNG TAHUN 2023. Diploma thesis, Poltekkes KemenkesTanjungkarang.

SAFITRI, WAHYUNING (2020) ASUHAN KEPERAWATAN PERIOPERATIF PADA PASIEN KEHAMILAN G3P2A0 ATERM INPARTU PRE-EKLAMPSI BERATDENGANTINDAKAN OPERASISECTIO CAESAREADIRUANG OPERASI RUMAH SAKIT PERTAMINA BINTANG AMIN BANDAR LAMPUNGTAHUN 2020. Diploma thesis, Poltekkes Tanjungkarang.

SAFITRI, WIKA (2021) ASUHAN KEPERAWATAN GERONTIK DENGAN NYERI KRONIS TERHADAP Ny.S PADA KASUS RHEUMATOID ARTRITIS DI DESA MULANG MAYA KECAMATAN KOTABUMI SELATAN KABUPATEN LAMPUNG UTARA TANGGAL 23-25 MARET 2021. Diploma thesis, Poltekkes Tanjungkarang.

SAGITA, YOSSI PRIMA (2022) ASUHAN KEPERAWATAN JIWA DENGAN GANGGUAN PERSEPSI SENSORI: HALUSINASI PENDENGARAN PADA KASUS SKIZOFRENIA TERHADAP Tn. D DI RUANG NURI RUMAH SAKIT JIWA DAERAH PROVINSI LAMPUNG TANGGAL 22-26 MARET 2022. Diploma thesis, Poltekkes Tanjungkarang.

SAHRONI, MA’RUF (2022) ASUHAN KEPERAWATAN POST OPERATIF PADA PASIEN KANKER PAYUDARA DEXTRA DENGAN TINDAKAN MASTEKTOMI DI RSUD JENDRAL AHMAD YANI METRO TAHUN 2021. Diploma thesis, Poltekkes Tanjungkarang.

SAJIWO, M DIMAS BAGUS (2022) ASUHAN KEPERAWATAN KELUARGA DENGANGANGGUAN AMAN NYAMAN PADA KASUS HIPERTENSI TERHADAP Ny.M DI DESA MULANG MAYAKEC. KOTABUMI SELATAN KAB. LAMPUNG UTARA TANGGAL 21-26 FEBRUARI 2022. Diploma thesis, Poltekkes Tanjungkarang.

SAKHI, PUTRI NAURA (2023) ASUHAN KEPERAWATAN GANGGUAN KEBUTUHAN AKTIVITAS ISTIRAHAT MOBILITAS FISIK PADA NY.S DENGAN POST PARTUM SECTIO CAESAREA DI RUMAH SAKIT DKT TK IV 02.07.04 KOTA BANDAR LAMPUNG TAHUN 2023. Diploma thesis, Poltekkes KemenkesTanjungkarang.

SAKILA, MONICA HOLI (2022) ASUHAN KEPERAWATAN PERIOPERATIF PADA PASIEN CLOSE FRAKTUR FEMUR DENGAN TINDAKAN OPEN REDUCTION INTERNAL FIXATION DI RSUD JEND. A. YANI KOTA METRO TAHUN 2022. Diploma thesis, Poltekkes Tanjungkarang.

SAKILA, MONICA HOLI (2021) HUBUNGAN MOTIVASI DENGAN KEPATUHAN PENGGUNAAN ALAT PELINDUNG DIRI PERAWAT PERIOPERATIF DI RSUD JEND. A. YANI KOTA METRO TAHUN 2021. Diploma thesis, Poltekkes Tanjungkarang.

SALIHAH, KARTIKA AVILIANA (2021) ASUHAN KEPERAWATAN KELUARGA GANGGUAN KEBUTUHAN NUTRISI PADA BALITA KELUARGA BAPAK A DENGAN DIARE DI KAMPUNG BAYUR RAJABASA JAYA BANDAR LAMPUNG TAHUN 2021. Diploma thesis, Poltekkes Tanjungkarang.

SALIM, ZAM SALWA AZIZAH (2023) HUBUNGAN PERSEPSI BEBAN KERJA DENGAN KINERJA PERAWAT DI RUANG BEDAH RSUD DR. H. ABDUL MOELOEK PROVINSI LAMPUNG TAHUN 2023. Diploma thesis, Poltekkes KemenkesTanjungkarang.

SALIM, ZAM SALWA AZIZAH (2023) HUBUNGAN PERSEPSI BEBAN KERJA DENGAN KINERJA PERAWAT DI RUANG BEDAH RSUD DR. H. ABDUL MOELOEK PROVINSI LAMPUNG TAHUN 2023. Diploma thesis, Poltekkes KemenkesTanjungkarang.

SALIM, ZAM SALWA AZIZAH (2023) HUBUNGAN PERSEPSI BEBAN KERJA DENGAN KINERJA PERAWAT DI RUANG BEDAH RSUD DR. H. ABDUL MOELOEK PROVINSI LAMPUNG TAHUN 2023. Diploma thesis, Poltekkes KemenkesTanjungkarang.

SALIM, ZAM SALWA AZIZAH (2023) ZAM SALWA AZIZAH SALIM 1914301024. Diploma thesis, Poltekkes KemenkesTanjungkarang.

SALSABELA, PUTRI ALIVIA (2023) ASUHAN KEPERAWATAN PASIEN DENGAN RESIKO PERILAKU KEKERASAN PADA KASUS SKIZOFRENIA TERHADAP Tn.R DI RUANG NURI RUMAH SAKIT JIWA DAERAH PROVINSI LAMPUNG TANGGAL 14-16 MARET 2022. Diploma thesis, Poltekkes Kemenkes Tanjungkarang.

SALSABELLA, CHARITA (2022) ASUHAN KEPERAWATAN PERIOPERATIF PADA PASIEN APENDISITIS DENGAN TINDAKAN APENDIKTOMI DI RUMAH SAKIT MARDI WALUYO METRO TAHUN 2022. Diploma thesis, Poltekkes Tanjungkarang.

SALSABELLA, YUZA HAURA (2023) HUBUNGAN LAMA KERJA PERAWAT TERHADAP KEJADIAN LOW BACK PAIN DI RUANG BEDAH RUMAH SAKIT UMUM DAERAH Dr. Hi. ABDUL MOELOEK PROVINSI LAMPUNG TAHUN 2023. Diploma thesis, Poltekkes KemenkesTanjungkarang.

SALSABILA, NADA (2022) ASUHAN KEPERAWATAN PERIOPERATIF PADA PASIEN CARCINOMA MAMMAE DENGAN TINDAKAN OPERASI MASTEKTOMI RADIKAL MODIFIKASI (MRM) DI RUMAH SAKIT MARDI WALUYO METRO TAHUN 2022. Diploma thesis, Poltekkes Tanjungkarang.

SALSABILA, PUTRI TALITA (2022) ASUHAN KEPERAWATAN GANGGUAN KEBUTUHAN RASANYAMAN (NYERI AKUT) PADA PASIEN PASCAAPENDEKTOMIDI RUANG BEDAH RSUD Dr. A. DADI TJOKRODIPO BANDAR LAMPUNG TAHUN 2022. Diploma thesis, Poltekkes Tanjungkarang.

SALSABILA, RESTI INDI (2022) ASUHAN KEPERAWATAN GANGGUAN KEBUTUHAN NYERI DAN KENYAMANAN PADA PASIEN ULKUS DIABETES MELITUS PEDIS DEKSTRA DI RUANG BEDAH RSUD JENDERAL AHMAD YANI METRO TAHUN 2022. Diploma thesis, Poltekkes Tanjungkarang.

SALSAHBILA, DINI (2021) ASUHAN KEPERAWATAN ANAK USIA SEKOLAH GANGGUAN INTEGRITAS KULIT PADA REMAJA ANAK R KELUARGA BAPAK Z DENGAN DERMATITIS DI DESA RAJABASA BANDAR LAMPUNG TAHUN 2021. Diploma thesis, Poltekkes Tanjungkarang.

SANI, DIAN ANIS (2023) HUBUNGAN KEMAMPUAN OTONOMI PASIEN DENGAN METODE PEMBERIAN INFORMED CONSENT PADA PASIEN OPERASI ELEKTIF DI RUANG RAWAT INAP BEDAH RSUD Dr. H. ABDUL MOELOEK PROVINSI LAMPUNG TAHUN 2023. Diploma thesis, Poltekkes KemenkesTanjungkarang.

SANI, NINDA MUTIA (2020) ASUHAN KEPERAWATAN PERIOPERATIF PADA PASIEN DENGAN DIAGNOSA MEDIS OSTEOMIELITIS PEDIS DENGAN TINDAKAN DEBRIDEMENT DI RUMAH SAKIT AIRAN RAYA. Diploma thesis, Poltekkes Tanjungkarang.

SANTI, NURWISUDA (2022) ASUHAN KEPERAWATAN GANGGUAN KEBUTUHAN TERMOREGULASI (HIPERTERMIA) PADA PASIEN DHF DI RUMAH SAKIT BHAYANGKARA POLDA LAMPUNG TAHUN 2022. Diploma thesis, Poltekkes Tanjungkarang.

SANTIKA, EVA (2023) ASUHAN KEPERAWATAN PASIEN DENGAN GANGGUAN RASA AMAN NYAMAN PADA KASUS POST SECTIO CAESAREA TERHADAP Ny.M DIRUANG KEBIDANAN RSU HANDAYANI KOTABUMI KABUPATEN LAMPUNG UTARA TANGGAL 27-29 MARET 2023. Diploma thesis, Poltekkes Kemenkes Tanjungkarang.

SAODAH, SITI (2020) HUBUNGAN SKOR SINCLAIR DENGAN DIAGNOSA KEPERAWATAN NAUSEA PADA PASIEN POST OPERASI DENGAN ANASTESI UMUM. Diploma thesis, Poltekkes Tanjungkarang.

SAPITRI, AGNES MEILIANA (2023) ASUHAN KEPERAWATAN GERONTIK DENGAN GANGGUAN OKSIGENASI TERHADAP TN.S PADA KASUS ASMA DI DESA KOTA ALAM KEC.KOTABUMI SELATAN KAB.LAMPUNG UTARA TANGGAL 16-18MARET 2023. Diploma thesis, Poltekkes Kemenkes Tanjungkarang.

SAPUTRA, ANDI (2022) ASUHAN KEPERAWATAN GANGGUAN KEBUTUHAN RASA AMAN NYAMAN (NYERI) PADA POST OP ULKUS PASIEN DIABETES MELITUS DI RUANGAN KARMELIA RUMAH SAKIT DKT TK.IV.02.04.07 DENKESYAH LAMPUNG TAHUN 2022. Diploma thesis, Poltekkes Tanjungkarang.

SAPUTRA, DEDY JAYA (2023) ASUHAN KEPERAWATAN PASIEN DENGAN GANGGUAN AKTIVITAS DAN ISTIRAHAT PADA KASUS STROKE NON HEMORAGIK TERHADAP Tn. S DI RUANG FREESIA RSU HANDAYANI KOTABUMI LAMPUNG UTARA 10-13 OKTOBER 2022. Diploma thesis, Poltekkes Kemenkes Tanjungkarang.

SAPUTRA, GURUH ARIE SANDI (2020) ASUHAN KEPERAWATAN GANGGUAN PEMENUHAN KEBUTUHAN PERSONAL HYGIENE PADA KLIEN DEMENSIA DI UPTD PSLU TRESNA WERDHA NATAR KABUPATEN LAMPUNG SELATAN TAHUN 2020. Diploma thesis, Poltekkes Tanjungkarang.

SAPUTRA, HANIF ANDALAS (2023) ASUHAN KEPERAWATAN GANGGUAN KEBUTUHAN NUTRISI PADA PASIEN THYPOID DI RUMAH SAKIT BHAYANGKARA POLDA LAMPUNG TAHUN 2023. Diploma thesis, Poltekkes KemenkesTanjungkarang.

SAPUTRA, KURNIA AHMAD (2023) ASUHAN KEPERAWATAN GANGGUAN KEBUTUHAN TERMOREGULASI PADA PASIEN HIPERTERMIA DI RUANG ALAMANDA RSUD DR. H. ABDUL MOELOEK PROVINSI LAMPUNG TAHUN 2023. Diploma thesis, Poltekkes KemenkesTanjungkarang.

SAPUTRA, MELDY AJI (2020) ASUHAN KEPERAWATANGANGGUAN PEMENUHAN KEBUTUHAN MOBILISASI PADA PASIEN POST OP FRAKTUR EKSTREMITAS BAWAH DI RUANG GELATIK RSUD. Dr. H. ABDUL MOELOEK PROVINSI LAMPUNG TAHUN 2020. Diploma thesis, Poltekkes Tanjungkarang.

SAPUTRA, YOGI (2020) ASUHAN KEPERAWATAN GANGGUAN MOBILITAS PADA LANJUT USIA DENGAN OSTEOARTHRITIS DI UPTD TRESNA WERDA NATAR LAMPUNG SELATAN TAHUN 2020. Diploma thesis, Poltekkes Tanjungkarang.

SAPUTRI, ANISA NADA (2023) ASUHAN KEPERAWATAN GANGGUAN KEBUTUHAN ISTIRAHAT DAN TIDUR PADA KLIEN ABLASIO RETINA DAN HIPERTENSI DI DUSUN SRIMULYO I PEMANGILAN NATAR LAMPUNG SELATAN TAHUN 2023. Diploma thesis, Poltekkes KemenkesTanjungkarang.

SAPUTRI, CORNELIA A (2023) ASUHAN KEPERAWATAN PASIEN DENGAN GANGGUAN MOBILITAS FISIK PADA KASUS POST SECTIO CAESAREA TERHADAP NY.A DI RUANG KEBIDANAN RSU HANDAYANI KOTABUMI LAMPUNG UTARA TANGGAL 29-31 MARET 2023. Diploma thesis, Poltekkes Kemenkes Tanjungkarang.

SAPUTRI, EKA YULIA (2021) ASUHAN KEPERAWATAN GERONTIK TERHADAP Ny.MDENGAN GANGGUAN AMAN NYAMAN PADA KASUS ARTHRITIS RHEUMATOID DI DESA MARGOTOTO KECAMATAN METROKIBANG KABUPATEN LAMPUNG TIMUR TANGGAL 22-24 MARET 2021. Diploma thesis, Poltekkes Tanjungkarang.

SAPUTRI, ELGALENIA MARTHA (2023) ASUHAN KEPERAWATAN GANGGUAN KEBUTUHAN SIRKULASI PADA PASIEN DENGAN ANEMIA DI RUANG PENYAKIT DALAM RSUD Dr. A. DADI TJOKRODIPO KOTA BANDAR LAMPUNG TAHUN 2023. Diploma thesis, Poltekkes KemenkesTanjungkarang.

SAPUTRI, ELISA (2021) ASUHAN KEPERAWATAN GANGGUAN KEBUTUHAN OKSIGENASI PADA ANAK A KELUARGA BAPAK S DENGAN INFEKSI SALURAN PERNAPASAN AKUT DI DESA REJOMULYO KECAMATAN JATI AGUNG LAMPUNG SELATAN TAHUN 2021. Diploma thesis, Poltekkes Tanjungkarang.

SAPUTRI, INDAH (2023) ASUHAN KEPERAWATAN KELUARGA DENGAN GANGGUAN AKTIVITAS PADA KASUS STROKE TERHADAP TN. J DI WILAYAH KERJA PUSKESMAS KOTABUMI II KABUPATEN LAMPUNG UTARA TANGGAL 27-29 MARET 2023. Diploma thesis, Poltekkes Kemenkes Tanjungkarang.

SARASWATI, DEWA AYU SUKMA (2020) ASUHAN KEPERAWATAN GANGGUAN KEBUTUHAN CAIRAN DAN ELEKTROLIT PADA ANAK DENGAN DEMAM TIFOID DI PUSKESMAS KEDATON BANDAR LAMPUNG TAHUN 2020. Diploma thesis, Poltekkes Tanjungkarang.

SARASWATI, NI WAYAN AYUDYA (2021) ASUHAN KEPERAWATAN GANGGUAN PEMENUHAN KEBUTUHAN RASA NYAMAN NYERI DENGAN MASALAH KESEHATAN GOUT ARTHRITIS PADA TN.W DIDESA QURNIA MATARAM KECAMATAN SEPUTIH MATARAM LAMPUNG TENGAH TAHUN 2021. Diploma thesis, Poltekkes Tanjungkarang.

SARI, ADE VIKA (2022) ASUHAN KEPERAWATAN GANGGUAN KEBUTUHAN AMAN DAN NYAMAN: NYERI PADA PASIEN POST OPERASI LAPARATOMI APENDISITIS DI RUANG HIGH CARE UNIT (HCU) RS DR. A DADI TJOKRODIPO PROVINSI LAMPUNG TAHUN 2022. Diploma thesis, Poltekkes Tanjungkarang.

SARI, ADEK YUNITA (2023) ASUHAN KEPERAWATANNYERI AKUT DENGAN PENERAPAN SLOW DEEP BREATHING PADA PASIEN POST OP HEMORRHOIDECTOMY DI RSUDDr. H ABDUL MOELOEK PROVINSI LAMPUNG TAHUN 2023. Diploma thesis, Poltekkes Kemenkes Tanjungkarang.

SARI, AMELIA (2021) ASUHAN KEPERAWATAN KELUARGA GANGGUAN BERAT BADAN LEBIH PADA KELUARGA BAPAK H KHUSUSNYA ANAK R PADA TAHAP REMAJA DENGAN OVERWEIGHT DI DESA NEGERI RATU KECAMATAN MUARA SUNGKAI KABUPATEN LAMPUNG UTARA TAHUN 2021. Diploma thesis, Poltekkes Tanjungkarang.

SARI, AYU DEVITA (2021) ASUHAN KEPERAWATAN PASIEN DENGAN GANGGUAN RASA NYAMAN PADA KASUS DISPEPSIA TERHADAP NY. K DI RUANG FRESSIA LANTAI 3 RSU HANDAYANI KOTABUMI LAMPUNG UTARA TANGGAL 8-10 MARET 2021. Diploma thesis, Poltekkes Tanjungkarang.

SARI, DEVA OKTAVIA (2023) ASUHAN KEPERAWATAN GANGGUAN OKSIGENASI PADA KASUS STROKE NON HEMORAGIC (SNH) TERHADAP NY. T DI RUANG FREESIA RSU HANDAYANI KOTABUMI LAMPUNG UTARA TANGGAL 17-19 OKTOBER 2022. Diploma thesis, Poltekkes Kemenkes Tanjungkarang.

SARI, DIAN THALITA (2020) ASUHAN KEPERAWATAN GANGGUAN KEBUTUHAN AKTIVITAS PADA PASIEN FRAKTUR FEMUR DI RUANG GELATIKRSUD. Dr. H. ABDUL MOELOK PROVINSI LAMPUNG TAHUN 2020. Diploma thesis, Poltekkes Tanjungkarang.

SARI, FENNY KARLINA (2021) HUBUNGAN KADAR GLUKOSA DENGAN ASAM URAT PADA PASIEN PENDERITA DIABETES MELITUS TIPE 2 (STUDI PUSTAKA). Diploma thesis, Poltekkes Tanjungkarang.

SARI, FIFI NANDA (2023) ASUHAN KEPERAWATAN GANGGUAN KEBUTUHAN RASA NYAMAN PADA PASIEN HIPERTENSI DI RUANG KELAS 2,3 RUMAH SAKIT BHAYANGKARA POLDA LAMPUNG TAHUN 2023. Diploma thesis, Poltekkes Tanjungkarang.

SARI, GITA GUSPITA (2022) ASUHAN KEPERAWATAN PERIOPERATIF PADA PASIEN ULKUS DIABETIKUM DENGAN TINDAKAN AMPUTASI DIGITI IV PEDIS DEXTRA DI RUANG OPERASI RUMAH SAKIT BHAYANGKARA POLDA LAMPUNG TAHUN 2022. Diploma thesis, Poltekkes Tanjungkarang.

SARI, ISMA YUNITA (2023) HUBUNGAN KUALITAS PELAYANAN KESEHATAN DENGAN TINGKAT KEPUASAN PASIEN POST OPERASI DI RS YUKUM MEDICAL CENTRE LAMPUNG TENGAH TAHUN 2023. Diploma thesis, Poltekkes Kemenkes Tanjungkarang.

SARI, JAINURI ULAN (2020) ASUHAN KEPERAWATAN PASIEN DENGAN GANGGUAN KEBUTUHAN MOBILITAS FISIK DI RSUD Dr. ABDUL MOELOEK PROVINSI LAMPUNG TAHUN 2020. Diploma thesis, Poltekkes Tanjungkarang.

SARI, JULIA MAYANG (2021) ASUHAN KEPERAWATAN GANGGUAN PEMENUHAN KEBUTUHAN AMAN NYAMAN : KECEMASAN PADA KELUARGA BAPAK D KHUSUSNYA IBU H PADA TAHAP CHILD BEARING DENGAN KEHAMILAN TRIMESTER III DI KELURAHAN GARUNTANG BANDAR LAMPUNG TAHUN 2021. Diploma thesis, Poltekkes Tanjungkarang.

SARI, LISTIYA MAYA (2020) PENGARUH TERAPI BERMAIN POP-UP BOOK TERHADAP KECEMASAN PREOPERATIFPADA ANAK DIRUANG KEMUNING RSUD Dr. Hi. ABDUL MOELOEK PROVINSI LAMPUNGTAHUN 2020. Diploma thesis, Poltekkes Tanjungkarang.

SARI, MARETA (2020) ASUHAN KEPERAWATAN GANGGUAN KEBUTUHAN SPIRITUAL PADA LANSIA DENGAN KLIEN RHUMATOID ARTHRITIS DI UPTD PSLU TRESNA WERDHA NATAR KABUPATEN LAMPUNG SELATAN TAHUN 2020. Diploma thesis, Poltekkes Tanjungkarang.

SARI, NURLIANA (2020) ASUHAN KEPERAWATAN GANGGUAN KEBUTUHAN AKTIVITAS DAN ISTIRAHAT PADA PASIEN STROKE NON HEMORAGIC DI RUANG BEDAH SYARAF RSUD SUKADANA LAMPUNG TIMUR TAHUN 2020. Diploma thesis, Poltekkes Tanjungkarang.

SARI, OKTAFIYANI NUR INDAH (2020) ASUHAN KEPERAWATAN GANGGUAN KEBUTUHAN OKSIGENASI PADA PASIEN DENGAN TUBERKULOSIS PARU DI RUANG MELATI RSUD. Dr. H. ABDUL MOELOEK PROVINSI LAMPUNG TAHUN 2020. Diploma thesis, Poltekkes Tanjungkarang.

SARI, PUTRI KURNIA (2023) PENERAPAN MODERN DRESSING PADA PASIEN POST DEBRIDEMEN ULKUS DIABETIKUM DI RUMAH SAKIT MARDI WALUYO KOTA METRO, LAMPUNG TAHUN 2023. Diploma thesis, Poltekkes Kemenkes Tanjungkarang.

SARI, RANI DEVIKA (2020) PENGARUH TEKNIK ABDOMINAL BREATHING TERHADAP KUALITAS TIDUR IBU POST OPERASI SECTIO CAESAREA DI RUANG DELIMA RSUD DR. H. ABDUL MOELOEK PROVINSI LAMPUNG TAHUN 2020. Diploma thesis, Poltekkes Tanjungkarang.

SARI, RANNY AFLIA (2023) ASUHAN KEPERAWATAN PASIEN DENGAN GANGGUAN RASA NYAMAN PADA KASUS POST SECTIO CAESAREA TERHADAP Ny.V DI RUANG KEBIDANAN RSU HANDAYANI KOTABUMI LAMPUNG UTARA TANGGAL 28-30 MARET 2023. Diploma thesis, Poltekkes Kemenkes Tanjungkarang.

SARI, REGINA NOVITA (2021) ASUHAN KEPERAWATAN KELUARGA DENGAN GANGGUAN PEMENUHAN KEBUTUHAN BELAJAR: DEFISIT PENGETAHUAN TENTANG GADGET PADA KELUARGA BAPAK H DENGAN TAHAP ANAK USIA SEKOLAH DI WILAYAH NATAR LAMPUNG SELATAN TAHUN 2021. Diploma thesis, Poltekkes Tanjungkarang.

SARI, RESA LUKITA (2020) ASUHAN KEPERAWATAN PASIEN DENGAN GANGGUAN KEBUTUHAN KEAMANAN PADA KASUS POST SECTIO CAESAREA TERHADAP NY. S DI RUANG KEBIDANAN RSD MAYJEND HM RYACUDU KOTABUMI LAMPUNG UTARA TANGGAL 18-20APRIL 2019. Diploma thesis, Poltekkes Tanjungkarang.

SARI, REVI PERMATA (2022) ASUHAN KEPERAWATAN PERIOPERATIF PADA ANAK HIRSCHSPRUNG’s DISEASE DENGAN TINDAKAN PULL THROUGH DI RS MARDI WALUYO METRO TAHUN 2022. Diploma thesis, Poltekkes Tanjungkarang.

SARI, REVI PERMATA (2022) ASUHAN KEPERAWATAN PERIOPERATIF PADA ANAK HIRSCHSPRUNG’s DISEASE DENGAN TINDAKAN PULL THROUGH DI RS MARDI WALUYO METRO TAHUN 2022. Diploma thesis, Poltekkes Tanjungkarang.

SARI, REVI PERMATA (2021) HUBUNGAN FASILITAS DISCHARGE PLANNING DENGAN MOTIVASI PERAWAT PERIOPERATIF MEMBERIKAN PENDIDIKAN KESEHATAN DI RSUD JEND. A. YANI METRO TAHUN 2021. Diploma thesis, Poltekkes Tanjungkarang.

SARI, RIANA PUSPITA (2022) ASUHAN KEPERAWATAN GANGGUAN PERTUKARAN GAS PADA PASIEN PPOK DI RUANG PARU RSUD. DR. A. DADI TJOKRODIPO BANDAR LAMPUNG TAHUN 2022. Diploma thesis, Poltekkes Tanjungkarang.

SARI, RIKA NOVITA (2022) ASUHAN KEPERAWATAN DENGAN GANGGUAN KEBUTUHANSIRKULASI PADA PASIEN DENGAN ANEMIA DI RUANGPENYAKIT DALAMBRSUD JENDERAL AHMAD YANI KOTAMETRO LAMPUNG TAHUN 2022. Diploma thesis, Poltekkes Tanjungkarang.

SARI, RISKA ANGGUN (2021) ASUHAN KEPERAWATAN PERIOPERATIF PADA PASIEN G1P0A0 +KPD DENGAN TINDAKAN SECTIO CAESAREA DI RUANG OPERASI RUMAH SAKIT BHAYANGKARA BANDAR LAMPUNG TAHUN 2021. Diploma thesis, Poltekkes Tanjungkarang.

SARI, YUNI PURNAMA (2023) ASUHAN KEPERAWATAN GANGGUAN KEBUTUHAN OKSIGEN PADA PASIEN STROKE DI RUANG ICU RSUD Dr. H. ABDUL MOELOEK TAHUN 2023. Diploma thesis, Poltekkes KemenkesTanjungkarang.

SARTIKA, ERINA DWI (2020) ASUHAN KEPERAWATAN PERIOPERATIF PADA PASIEN SPINAL CANAL STENOSIS LUMBAL (SCSL) DENGAN TINDAKAN OPERASI LAMINECTOMY DI INSTALANSI BEDAH SENTRAL RSUD JEND. A. YANI METRO TAHUN 2020. Diploma thesis, Poltekkes Tanjungkarang.

SASONGKO, SIMSON WINDU (2022) ASUHAN KEPERAWATAN GANGGUAN KEBUTUHAN AMAN NYAMAN PADA PASIEN POST OPERASI ABSES PERIANAL DI RUANG MAWAR RSU DKT BANDAR LAMPUNG PROVINSI LAMPUNG TAHUN 2022. Diploma thesis, Poltekkes Tanjungkarang.

SATRIAWAN, KETUT AGUS (2021) ASUHAN KEPERAWATAN GANGGUAN PEMENUHAN KEBUTUHAN OKSIGENASI PADA TN.Y DENGAN TUBERKULOSIS PARU DI DESA PUNGGUR LAMPUNG TENGAH PROVINSI LAMPUNG TAHUN 2021. Diploma thesis, Poltekkes Tanjungkarang.

SAVERA, IRNI (2021) ASUHAN KEPERAWATAN GANGGUAN KEBUTUHAN NUTRISI PADA IBU E KELUARGA BAPAK H DENGAN ANEMIA DI KELURAHAN CAMPANG JAYA KECAMATAN SUKABUMI BANDAR LAMPUNG TAHUN 2021. Diploma thesis, Poltekkes Tanjungkarang.

SECSANO, REVIKA ANAZTI (2020) ASUHAN KEPERAWATAN PERIOPERATIF PADA PASIEN FIBROADENOMA MAMMAE DENGAN TINDAKAN EKSISI DIRUANG OK RS. DKT PROVINSI LAMPUNG TAHUN 2019. Diploma thesis, Poltekkes Tanjungkarang.

SEELVIA, SEELVIA (2020) PENGARUH TEKNIK AFIRMASI TERHADAP TINGKAT KECEMASAN ORANG TUA PASIEN PRE OPERATIF DI RUANG KEMUNING RSUD. Dr. H. ABDUL MOELOEK PROVINSI LAMPUNG TAHUN 2020. Diploma thesis, Poltekkes Tanjungkarang.

SEFLINDA, SEFLINDA (2021) ASUHAN KEPERAWATAN GANGGUAN PEMENUHAN INTEGRITAS KULIT PADA REMAJA NN.M KELUARGA TN.S DENGAN MASALAH URTIKARIA DI DESA KARANG ANYAR KECAMATAN JATI AGUNG KABUPATEN LAMPUNG SELATAN PROVINSI LAMPUNG TAHUN 2021. Diploma thesis, Poltekkes Tanjungkarang.

SELFIA, FENI (2021) ASUHAN KEPERAWATAN GANGGUAN KEBUTUHANNYERI PADA REMAJA DENGAN DISMENORE PADA KELUARGA BAPAK A DIDESA TANJUNG HERAN KECAMATAN PUGUNG KABUPATENTANGGAMUSPROVINSILAMPUNG TAHUN 2021. Diploma thesis, Poltekkes Tanjungkarang.

SELVARENA, FARICHA SELSA (2022) ASUHANKEPERAWATANGANGGUANKEBUTUHAN AMANDANNYAMAN(NYERI)PADAPASIENDIABETES MELITUSPOSTDEBRIDEMENTRSUDDr.ADADI TJOKRODIPO BANDAR LAMPUNG TAHUN2022. Diploma thesis, Poltekkes Tanjungkarang.

SENJA, AMELIA (2021) ASUHAN KEPERAWATAN PASIEN DENGAN GANGGUAN KEBUTUHAN OKSIGENASI PADA KASUS STROKE HEMORAGIK TERHADAP Ny.S DI RUANG SYARAF RSD MAYJEND HM RYACUDU KOTABUMI LAMPUNG UTARA TANGGAL 11-13 MARET 2021. Diploma thesis, Poltekkes Tanjungkarang.

SEPRIANI, MUTIARA AGEL (2022) ASUHAN KEPERAWATAN PERIOPERATIF PADA PASIEN G1P0A0 37 MINGGU INDIKASI LETAK SUNGSANG DENGAN TINDAKAN SECTIO CAESAREA DI RSUD JENDRAL AHMAD YANI METRO TAHUN 2022. Diploma thesis, Poltekkes Tanjungkarang.

SEPTIANA, EMILIA ADELINE CLARA (2023) ASUHAN KEPERAWATAN GANGGUAN KEBUTUHAN NUTRISI PADA KLIEN GASTRITIS DI DESA PEMANGGILAN KECAMATAN NATAR LAMPUNG SELATAN TAHUN 2023. Diploma thesis, Poltekkes KemenkesTanjungkarang.

SEPTIANI, NIA (2021) ASUHAN KEPERAWATAN GANGGUAN RASA NYAMAN NYERI PADA KELUARGA BAPAK S KHUSUSNYA NYONYA Y DENGAN HIPERTENSI DI DESA BALI SADHAR SELATAN KECAMATAN BANJIT KABUPATEN WAY KANAN TAHUN 2021. Diploma thesis, Poltekkes Tanjungkarang.

SEPTIANI, RESGIY (2021) ASUHAN KEPERAWATAN PASIEN DENGAN GANGGUAN OKSIGENASI PADA KASUS PNEUMONIA TERHADAP Ny.S DI RUANG FRESIA LANTAI 3 RS HANDAYANI KOTABUMI LAMPUNG UTARA TANGGAL 11-13 MARET 2021. Diploma thesis, Poltekkes Tanjungkarang.

SETIADI, ABDI (2022) ASUHAN KEPERAWATAN PERIOPERATIF PADA PASIEN HEMOROID DENGAN TINDAKAN HEMOROIDEKTOMI DI RUMAH SAKIT BHAYANGKARA TK III POLDA LAMPUNG TAHUN 2022. Diploma thesis, Poltekkes Tanjungkarang.

SETIANI, DIANA (2023) ASUHAN KEPERAWATAN PASIEN DENGAN GANGGUAN KEBUTUHAN SIRKULASI PADA PERDARAHAN POSTPARTUM TERHADAP NY. H DI RUANG KEBIDANAN RUMAH SAKIT UMUM HANDAYANI LAMPUNG UTARA PADA TANGGAL 29-31 MARET 2023. Diploma thesis, Poltekkes Kemenkes Tanjungkarang.

SETIAWAN, FAISAL AJI (2020) ASUHAN KEPERAWATAN GANGGUAN KEBUTUHAN SIRKULASI PADA IBU HAMIL TRIMESTER TIGA DENGAN PREEKLAMPSIA BERAT DI RUANG DELIMA RSUD. Dr. H. ABDUL MOELOK PROVINSI LAMPUNG TAHUN 2020. Diploma thesis, Poltekkes Tanjungkarang.

SETIAWAN, FAISAL AJI (2023) ASUHAN KEPERAWATAN POST PARTUM SECTIO CAESAREA GANGGUAN NYERI AKUT DENGAN INTERVENSI RELAKSASI BENSON DI RSUD JENDRAL AHMAD YANIKOTA METRO TAHUN 2023. Diploma thesis, Poltekkes Kemenkes Tanjungkarang.

SETIAWAN, WAYAN GEDE (2020) ASUHAN KEPERAWATAN GANGGUAN KEBUTUHAN MENGHINDARI BAHAYA LINGKUNGAN DAN MENGHINDARI MENCIDERAI ORANG LAIN PADA KLIEN DI SD NEGERI 1 HAJIMENA LAMPUNG SELATAN. Diploma thesis, Poltekkes Tanjungkarang.

SETIAWATI, MASRUROTUL ULYANA ISNA (2020) HUBUNGAN PENERAPAN SURGICAL SAFETY CHECKLIST DENGAN INSIDEN KESELAMATAN PASIEN PROVINSI LAMPUNG TAHUN 2020. Diploma thesis, Poltekkes Tanjungkarang.

SETYARINI, ENI (2020) ASUHAN KEPERAWATAN PERIOPERATIF PADA PASIEN KANKER PAYUDARA DENGAN TINDAKAN MASTEKTOMI DI RUANG INSTALASI BEDAH SENTRAL RSUD JEND.AHMAD YANI METRO TAHUN 2019. Diploma thesis, Poltekkes Tanjungkarang.

SHAFARINA, EFI (2022) PENGARUH TEKNIK RELAKSASI AUTOGENIK TERHADAP KECEMASAN PASIEN PRE OPERASI BEDAH MAYOR DI RUANG BEDAH SENTRAL RSUD Dr. H.ABDUL MOELOEK PROVINSI LAMPUNG. Diploma thesis, Poltekkes Tanjungkarang.

SHAFIRA, TAHSYA RIA (2021) ASUHAN KEPERAWATAN GANGGUAN KEBUTUHAN BELAJAR PADA ANAK USIA SEKOLAH KELUARGA BAPAK R KHUSUSNYA ANAK R DENGAN BAHAYA GADGET DI KECAMATAN BALIK BUKIT KABUPATEN LAMPUNG BARAT TAHUN 2021. Diploma thesis, Poltekkes Tanjungkarang.

SHELFIA, SHELFIA (2021) ASUHAN KEPERAWATAN GANGGUAN PEMENUHAN KEBUTUHAN MOBILISASI FISIK PADA KELUARGA BAPAK S KHUSUSNYA IBU J DENGAN STROKE TAHAP LANSIA DI DESA BANJAR AGUNG KECAMATAN PUGUNG TANGGAMUS TAHUN 2021 ASUHAN KEPERAWATAN GANGGUAN PEMENUHAN KEBUTUHAN MOBILISASI FISIK PADA KELUARGA BAPAK S KHUSUSNYA IBU J DENGAN STROKE TAHAP LANSIA DI DESA BANJAR AGUNG KECAMATAN PUGUNG TANGGAMUS TAHUN 2021. Diploma thesis, Poltekkes Tanjungkarang.

SHOLEH, IKA WADIF AZIZAH (2023) ASUHAN KEPERAWATANGANGGUAN KEBUTUHAN AMAN NYAMAN PADA PASIEN SINUSITIS MAKSILARIS DI RUMAH SAKIT BHAYANGKARA POLDA LAMPUNG TAHUN 2023. Diploma thesis, Poltekkes KemenkesTanjungkarang.

SIAHAAN, LUSYANA NIKITA (2022) ASUHAN KEPERAWATAN GANGGUAN KEBUTUHAN CAIRAN PADA ANAK DENGUE HEMORRHARGIC FEVER DI RUMAH SAKIT BHAYANGKARA POLDA LAMPUNG TAHUN 2022. Diploma thesis, Poltekkes Tanjungkarang.

SIAHAAN, LUSYANA NIKITA (2022) ASUHAN KEPERAWATAN GANGGUAN KEBUTUHAN CAIRAN PADA ANAK DENGUE HEMORRHARGIC FEVER DI RUMAH SAKIT BHAYANGKARA POLDA LAMPUNG TAHUN 2022. Diploma thesis, Poltekkes Tanjungkarang.

SIHOTANG, ENDANG NATALIA (2021) ASUHAN KEPERAWATAN GANGGUAN KEBUTUHAN NUTRISI PADA Nn. F KELUARGA Tn. S DENGAN GASTRITIS DI KECAMATAN KOTABUMI SELATAN LAMPUNG UTARA TAHUN 2021. Diploma thesis, Poltekkes Tanjungkarang.

SIJABAT, TIARA MARTATILOVA (2022) ASUHAN KEPERAWATAN GANGGUAN KEBUTUHAN NUTRISI PADA PASIEN DIABETES MELITUS DIRUANG KAMELIA RS TK. IV.02.07.04 DENKESYAH BANDAR LAMPUNG TAHUN 2022. Diploma thesis, Poltekkes Tanjungkarang.

SINAMBELA, VERA MONICA (2021) ASUHAN KEPERAWATAN KELUARGA TERHADAPINDIVIDU NY. S DENGAN GANGGUAN AMAN NYAMANPADA KASUS STROKE DIWILAYAH KERJA PUSKESMASKOTABUMI II KABUPATENLAMPUNG UTARA TANGGAL 23-26 MARET 2021. Diploma thesis, Poltekkes Tanjungkarang.

SINTAWATI, INE (2022) ASUHAN KEPERAWATAN GAWAT DARURAT DENGAN GANGGUAN OKSIGENASI KASUS CEDERA KEPALA BERAT PADA TN. K DI RUANG IGD RSUD JENDRAL AHMAD YANI METRO TANGGAL 22 NOVEMBER 2021. Diploma thesis, Poltekkes Tanjungkarang.

SITINJAK, NOVIANNA ULY (2022) ASUHAN KEPERAWATAN PERIOPERATIF PADA PASIEN KETUBAN PECAH DINI DENGAN TINDAKAN SC DI RUMAH SAKIT MARDI WALUYO TAHUN 2022. Diploma thesis, Poltekkes Tanjungkarang.

SITINJAK, NOVIANNA ULY (2021) PENGARUH TERAPI BERMAIN MEWARNAI GAMBAR TERHADAP TINGKAT KECEMASAN ANAK USIA PRASEKOLAH PRE OPERASI DI RSUD JENDRAL AHMAD YANI METRO PROVINSI LAMPUNG. Diploma thesis, Poltekkes Tanjungkarang.

SITORUS, MEGAWATI UTAMI SEPTIANI (2021) ASUHAN KEPERAWATAN GANGGUAN BERSIHAN JALAN NAFAS TIDAK EFEKTIF PADA KELUARGA PRA SEKOLAH BAPAK A KHUSUSNYA ANAK A DI DUSUN III SUMBER SARI HAJIMENA NATAR LAMPUNG SELATAN TAHUN 2021. Diploma thesis, Poltekkes Tanjungkarang.

SOLEHA, IDEALTI AJENG (2021) ASUHAN KEPERAWATAN GANGGUAN PEMENUHAN KEBUTUHAN MOBILITAS FISIK PADA BAPAK T KELUARGA BAPAK T DENGAN GOUT ARTHRITIS DI DESA NATAR KECAMATAN NATAR KABUPATEN LAMPUNG SELATAN TAHUN 2021. Diploma thesis, Poltekkes Tanjungkarang.

SRIWANTI, SRIWANTI (2021) ASUHAN KEPERAWATAN GERONTIK DENGAN GANGGUAN KEBUTUHAN RASA NYAMAN TERHADAP Ny. M PADA KASUS HIPERTENSI DI WILAYAH KERJA PUSKESMAS KOTABUMI II PADA TANGGAL 24 - 27 MARET 2021. Diploma thesis, Poltekkes Tanjungkarang.

SUBEKTI, RENI TRI (2021) ASUHAN KEPERAWATAN POST OPERATIF PADA PASIEN FRAKTUR FEMUR DEXTRA DENGAN TINDAKAN ORIF (OPEN REDUCTION INTERNAL FIXATIE) DI RUMAH SAKIT BHAYANGKARA BANDAR LAMPUNG TAHUN 2021. Diploma thesis, Poltekkes Tanjungkarang.

SUCIATI, SUCIATI (2021) ASUHAN KEPERAWATAN GANGGUAN RASA NYAMAN NYERI PADA KELUARGA TN.M KHUSUSNYA AN.M DENGAN KARIES GIGI DI KELURAHAN KOTA ALAM KOTABUMI LAMPUNG UTARA TAHUN 2021. Diploma thesis, Poltekkes Tanjungkarang.

SUCITA, PUTRI AYU (2020) ASUHAN KEPERAWATAN PERIOPERATIF PADA PASIEN DIABETES MELITUS DENGAN TINDAKAN DEBRIDEMEN DI RUANG OPERASI JENDERAL AHMAD YANI METRO TAHUN 2019. Diploma thesis, Poltekkes Tanjungkarang.

SUDIASIH, WAYAN (2021) ASUHAN KEPERAWATAN PERIOPERATIF DEBRIDEMEN PADA PASIEN ULKUS DIABETIKUM DI RSUD MENGGALA TAHUN 2021. Diploma thesis, Poltekkes Tanjungkarang.

SUHARTI, IHSANAT REFI (2021) ASUHAN KEPERAWATAN PERIOPERATIF DENGAN ABSES LEHER EC DIABETES MELITUS PADA TN. R DENGAN TINDAKAN OPERASI DEBRIDEMENT DI RUANG OPERASI RSUD Dr. H. BOB BAZAR, SKM KALIANDA TAHUN 2021. Diploma thesis, Poltekkes Tanjungkarang.

SUHARTI, IHSANAT REFI (2020) PENGARUH ROM PASIF EKSTREMITAS TERHADAP WAKTU PULIH SADAR PADA PASIEN POST OPERASI DENGAN ANESTESI UMUM DI RSUD Dr. H. ABDUL MOELOEK PROVINSI LAMPUNG TAHUN 2020. Diploma thesis, Poltekkes Tanjungkarang.

SUHENDRA, MEIQI (2022) ASUHAN KEPERAWATAN PERIOPERATIF PADA PASIEN CARCINOMA MAMMAE DENGAN TINDAKAN MASTEKTOMI DI RUMAH SAKIT BHAYANGKARA POLDA LAMPUNG TAHUN 2022. Diploma thesis, Poltekkes Tanjungkarang.

SUKMA, DITHA MIRANDA (2023) ASUHAN KEPERAWATAN GANGGUAN KEBUTUHAN OKSIGENASI PADA KASUS BRONKIEKTASIS TERHADAP NY.T DIRUANGAN PARU DI RSUD MAYJEND HM RYACUDU LAMPUNG UTARA PADA TANGGAL 12-14 OKTOBER 2022. Diploma thesis, Poltekkes Kemenkes Tanjungkarang.

SUKMA, MEGA MELATI (2023) ASUHAN KEPERAWATAN GANGGUAN KEBUTUHAN RASA NYAMAN PADA PASIEN POST PARTUM SPONTAN DENGAN KASUS KETUBAN PECAH DINI DI RUANG DELIMA RSUD.Dr. ABDUL MOELOEK PROVINSI LAMPUNG TAHUN 2023. Diploma thesis, Poltekkes KemenkesTanjungkarang.

SUKMAWATI, NI NYOMAN (2021) ASUHAN KEPERAWATAN GANGGUAN KEBUTUHAN NUTRISI BERLEBIH: OBESITAS PADA Nn. R KELUARGA Tn. S DIKAMPUNG BAYUR KECAMATAN RAJABASA KOTA BANDAR LAMPUNG TAHUN 2021. Diploma thesis, Poltekkes Tanjungkarang.

SULIANTIKA, RIA (2020) ASUHAN KEPERAWATAN GANGGUAN KEBUTUHAN PERSONAL HYGIENE DENGAN MASALAH DEFISIT PERAWATAN DIRI PADA KLIEN DEMENSIA DI UPTD PSLU TRESNA WERDHA NATAR KABUPATEN LAMPUNG SELATAN TAHUN 2020. Diploma thesis, Poltekkes Tanjungkarang.

SULISTYORINI, NISA WULANDARI (2021) GAMBARAN PENDERITA DIABETES MELITUS DI WILAYAH KERJA PUSKESMAS TAMBAH SUBUR KECAMATAN WAY BUNGUR KABUPATEN LAMPUNG TIMUR TAHUN 2018-2019. Diploma thesis, Poltekkes Tanjungkarang.

SULUFU, MUHAMMAD AKMAL (2020) ASUHAN KEPERAWATAN PERIOPERATIF PADA PASIEN KOLELITHIASIS DENGAN TINDAKAN LAPAROTOMI KOLESISTEKTOMI DI RUANG OK RS PERTAMINA BINTANG AMIN TAHUN 2020. Diploma thesis, Poltekkes Tanjungkarang.

SUMPENO, ARIF (2022) ASUHAN KEPERAWATAN GANGGUAN KEBUTUHAN RASA NYAMAN (NYERI) PADA PASIEN LOW BACK PAIN DI RUMAH SAKIT DKT. DENKESYAH LAMPUNG TAHUN 2022. Diploma thesis, Poltekkes Tanjungkarang.

SUPRAYOGI, HERI (2023) ASUHAN KEPERAWATAN NYERI AKUT PADA PASIEN POST OP HERNIOTOMI DENGAN INTERVENSI RELAKSASI GENGGAM JARI DI RUMAH SAKIT BHAYANGKARA POLDA LAMPUNG TAHUN 2023. Diploma thesis, Poltekkes Kemenkes Tanjungkarang.

SURAHMAN, AKBAR (2023) ASUHAN KEPERAWATAN PASIEN DENGAN GANGGUAN RASA AMAN NYAMAN PADA KASUS COMBUSTIO TERHADAP Tn. S DI RUANG BEDAH RSUD MAYJEND HM. RYACUDU KOTABUMI LAMPUNG UTARA TANGGAL 21-24 NOVEMBER 2022. Diploma thesis, Poltekkes Kemenkes Tanjungkarang.

SURI, ATIKA (2022) ASUHAN KEPERAWATAN PERIOPERATIF PADA PASIEN MIOMA UTERI DENGAN TINDAKAN HISTEREKTOMI DI RUMAH SAKIT MARDI WALUYO METRO TAHUN 2022. Diploma thesis, Poltekkes Tanjungkarang.

SURI, DEVI DIANA (2023) ASUHAN KEPERAWATAN GANGGUAN NYERI AKUT DENGAN INTERVENSI TEKNIK RELAKSASI NAPAS DALAM DAN TERAPI MUROTTAL PADA PASIEN POST PARTUM SECTIO CAESARIA DI RSUD dr Hi ABDUL MOELOEK PROVINSI LAMPUNG TAHUN 2023. Diploma thesis, Poltekkes Kemenkes Tanjungkarang.

SURYA, ANADYA (2023) ASUHAN KEPERAWATAN GANGGUAN KEBUTUHAN FISIOLOGIS SUBKATEGORI NEUROSENSORI DAN SIRKULASI PADA PASIEN STROKE INFARK DAN INTRACEREBRAL HEMORRHAGE (ICH) DI RUANG BOUGENVILE RSUD Dr.H. ABDUL MOELOEK PROVINSI LAMPUNG TAHUN 2023. Diploma thesis, Poltekkes KemenkesTanjungkarang.

SURYA, DANDY PUTRA (2020) PERBEDAAN KUALITAS TIDUR PADA PASIEN PREOPERASI SEBELUM DAN SESUDAH DIBERIKAN HIDRO-AROMATERAPI DI RSUD Dr. H. ABDUL MOELOEK PROVINSI LAMPUNG TAHUN 2020. Diploma thesis, Poltekkes Tanjungkarang.

SURYANINGSIH, NI NYOMAN SEKAR (2020) ASUHAN KEPERAWATAN GANGGUAN KEBUTUHAN CAIRAN DAN ELEKTROLIT PADA ANAK DENGAN DIARE DI PUSKESMAS RAWAT INAP PANJANG BANDAR LAMPUNG TAHUN 2020. Diploma thesis, Poltekkes Tanjungkarang.

SUSANTI, ELLY (2021) ASUHAN KEPERAWATAN GANGGUAN KEBUTUHAN TERMOREGULASI PADA ANAK L KELUARGA BAPAK S DENGAN THYPUS ABDOMINALIS DI DESA KURIPAN KECAMATAN KOTA AGUNG KABUPATEN TANGGAMUS TAHUN 2021. Diploma thesis, Poltekkes Tanjungkarang.

SUSANTI, MEILANY (2021) ASUHAN KEPERAWATAN GANGGUAN KEBUTUHAN RASA NYAMAN (NYERI) PADA ANAK M KELUARGA BAPAK H DENGAN DISMENOREA DI DESA MENYANCANG KECAMATAN KARYA PENGGAWA KABUPATEN PESISIR BARAT TAHUN 2021. Diploma thesis, Poltekkes Tanjungkarang.

SUSANTI, RIA (2020) ASUHAN KEPERAWATAN GANGGUAN KEBUTUHAN SIRKULASI PADA ANAK THALASEMIA DI RUANG ALAMANDA RSUD Dr. H. ABDUL MOELOEK PROVINSI LAMPUNG TAHUN 2020. Diploma thesis, Poltekkes Tanjungkarang.

SUSANTI, SUSI (2023) PENERAPAN TERAPI RELAKSASI NAFAS DALAM PADA PASIEN CERVICAL SPONDYLOTIC MYELOPATHY POST LAMINECTOMY DENGAN MASALAH NYERI AKUT DI RSUD AHMAD YANI KOTA METRO TAHUN 2023. Diploma thesis, Poltekkes Kemenkes Tanjungkarang.

SUSANTI, SUSI (2022) PENGARUH PEMBERIAN BACK MASSAGE THERAPY TERHADAP PENURUNAN INTENSITAS NYERIIBUPOST SECTIO CAESAREA DI RUANGDELIMARSUDDr.H.ABDUL MOELOEK PROVINSI LAMPUNG TAHUN 2022. Diploma thesis, Poltekkes Tanjungkarang.

SUSANTO, PARIYES (2021) ASUHAN KEPERAWATAN GANGGUAN SISTEM PERNAFASAN PADA PASIEN DENGAN DIAGNOSA MEDIS EFFUSI PLEURA DI RUANG MELATI RSUD dr. H ABDUL MOELOEK PROVINSI LAMPUNG TAHUN 2021. Diploma thesis, Poltekkes Tanjungkarang.

SUSILAWATI, YUNI (2023) ASUHAN KEPERAWATAN PASIENDENGANGANGGUANKEBUTUHAN AKTIVITAS ISTIRAHAT PADA KASUS POST SECTIO CAESAREA TERHADAP Ny. O DI RUANG KEBIDANAN RSU HANDAYANI KOTABUMILAMPUNG UTARA TANGGAL 21-23 MARET TAHUN 2023. Diploma thesis, Poltekkes Kemenkes Tanjungkarang.

SUSNITA, MELI (2020) ASUHAN KEPERAWATAN KELUARGA: GANGGUAN KEBUTUHAN RASA NYAMAN NYERI PADA KELUARGA DENGAN HIPERTENSI DI WILAYAH KERJA PUSKESMAS KEMILING BANDAR LAMPUNG TAHUN 2020. Diploma thesis, Poltekkes Tanjungkarang.

SUSYANTI, SUSI (2021) ASUHAN KEPERAWATAN GANGGUAN PEMENUHAN KEBUTUHAN RASA NYAMAN NYERI PADA KELUARGA Tn.N KHUSUSNYA Ny.M PADA TAHAP DEWASA DENGAN HIPERTENSI DI HAJIMENA KECAMATAN NATAR KABUPATEN LAMPUNG SELATAN TAHUN 2021. Diploma thesis, Poltekkes Tanjungkarang.

SUTANTO, HARYS (2021) ASUHAN KEPERAWATAN PERIOPERATIF PADA PASIEN FRAKTUR FEMUR 1/3 DISTAL SINISTRA DENGAN TINDAKAN OPEN REDUCTION INTERNAL FIXATION (ORIF) DI RUANG INSTALASI BEDAH SENTRAL RSUD DR H ABDUL MOELEOK PROPINSI LAMPUNG. Diploma thesis, Poltekkes Tanjungkarang.

SUTRISNAWATI, KETUT (2023) ASUHAN KEPERAWATAN GANGGUAN KEBUTUHAN RASA AMAN NYAMAN (NYERI ) PADA PASIEN COLIC ABDOMEN DI RUANG MELATI RUMAH SAKIT DKT DENKENSYAH BANDAR LAMPUNG TAHUN 2023. Diploma thesis, Poltekkes KemenkesTanjungkarang.

SYAFIRA, NABILA (2021) ASUHAN KEPERAWATAN GANGGUAN KEBUTUHAN ELIMINASI FEKAL PADA KELUARGA BP. I KHUSUSNYA AN. R (ANAK USIA SEKOLAH) DENGAN DIARE DI DESA TALANG PADANG TANGGAMUS LAMPUNG TAHUN 2021. Diploma thesis, Poltekkes Tanjungkarang.

SYAFITRI, AZVADILLA RAHMA (2022) ASUHAN KEPERAWATAN PASIEN DENGAN GANGGUAN MOBILITAS FISIK PADA KASUS POST SECTIO CAESAREA TERHADAP Ny.C DI RUANG KEBIDANAN RSU HANDAYANI KOTABUMI LAMPUNG UTARA TANGGAL 23-25 FEBRUARI 2022. Diploma thesis, Poltekkes Tanjungkarang.

SYAHRONI, ACHMAD (2020) PERBANDINGAN KUALITAS SEDIAAN APUSAN SITOLOGI PLEURA DAN BLOK SEL DENGAN PEWARNAAN HEMATOXILLIN EOSIN. Diploma thesis, Poltekkes Tanjungkarang.

SYAZA, SYAZA (2022) ASUHAN KEPERAWATAN PERIOPERATIF PADA PASIEN UROLITHIASIS DENGAN TINDAKAN URETEROSCOPIC LITHOTRIPSY PEMASANGAN DOUBLE J STENT DI RUMAH SAKIT YUKUM MEDICAL CENTER TAHUN 2022. Diploma thesis, Poltekkes Tanjungkarang.

SYEFIRA, ZANIA (2020) ASUHAN KEPERAWATAN GANGGUAN KEBUTUHAN AKTIVITAS PADA PASIEN STROKE NON HEMOROGIK DI RUANG SYARAF RSUD JENDRAL AHMAD YANI KOTA METRO TAHUN 2020. Diploma thesis, Poltekkes Tanjungkarang.

SYEFIRA, ZANIA (2023) PENGARUH PENDIDIKAN KESEHATAN DENGAN MEDIA YOUTUBE TERHADAP PENGETAHUAN KELUARGA TENTANG PERSIAPAN OPERASI RSUD Dr. H. ABDUL MOELOEK PROVINSI LAMPUNG TAHUN 2022. Diploma thesis, Poltekkes KemenkesTanjungkarang.

Safitri, Ade Rosalina (2022) ASUHAN KEPERAWATAN PASIEN DENGAN GANGGUAN OKSIGENASI PADA KASUS PNEUMONIA TERHADAP TN. B DI RUANG FRESIA LANTAI 3 RSU HANDAYANI KOTABUMI LAMPUNG UTARA TANGGAL 9 – 11 MARET 2022. Diploma thesis, Poltekkes Tanjungkarang.

Sagita, Yossi Prima (2022) ASUHAN KEPERAWATAN JIWA DENGAN GANGGUAN PERSEPSI SENSORI: HALUSINASI PENDENGARAN PADA KASUS SKIZOFRENIA TERHADAP Tn. D DI RUANG NURI RUMAH SAKIT JIWA DAERAH PROVINSI LAMPUNG TANGGAL 22-26 MARET 2022. Diploma thesis, Poltekkes Tanjungkarang.

Sapitri, Delvi Kurnia (2022) ASUHAN KEPERAWATAN PASIEN DENGAN GANGGUAN KEBUTUHAN CAIRANPADA KASUS DENGUE HAEMORHAGIC FEVER(DHF) TERHADAP An. L DI RUANG EDELWEIS LANTAI II RSU HANDAYANI KOTABUMI LAMPUNG UTARA TANGGAL 28 FEBRUARI - 2 MARET 2022. Diploma thesis, Poltekkes Tanjungkarang.

Saputra, Ahmad Ardi (2022) ASUHAN KEPERAWATANPASIEN DENGAN KEBUTUHAN NUTRISI PADA DIABETES MELLITUS TIPE 2 TERHADAP Tn. I DI RUANG FREESIA LANTAI 3 RSU HANDAYANI KOTABUMI LAMPUNG UTARA TANGGAL 16-18 MARET 2022. Diploma thesis, Poltekkes Tanjungkarang.

Sari, Eka Widia (2022) ASUHAN KEPERAWATAN GAWAT DARURAT DENGAN GANGGUAN KESEIMBANGAN CAIRAN PADA KASUS GAGAL GINJAL KRONIK TERHADAP Tn.Y DI RUANG INSTALASI GAWAT DARURAT RSU HANDAYANI TANGGAL 29-31 NOVEMBER 2021. Diploma thesis, Poltekkes Tanjungkarang.

Sari, Anggi Diah Putri Permata (2023) ASUHAN KEPERAWATAN GANGGUAN KEBUTUHAN NYAMAN (NYERI) PADA PASIEN COLIC ABDOMEN DI RUANG PENYAKIT DALAM RUMAH SAKIT TK IV 02.07.04 DENKESYAH 02.04.03 PROVINSI LAMPUNG TAHUN 2023. Diploma thesis, Poltekkes KemenkesTanjungkarang.

Sari, Annisa Marrizka (2023) ASUHAN KEPERAWATAN GERONTIK DENGAN GANGGUAN RASA NYAMAN TERHADAP TN. M PADA KASUS GOUT ARTHRITIS DI DESA MULANG MAYA KEC. KOTABUMI SELATAN KAB. LAMPUNG UTARA TANGGAL 25 – 27 OKTOBER 2022. Diploma thesis, Poltekkes Kemenkes Tanjungkarang.

Sari, Febiola Amelia (2022) ASUHAN KEPERAWATAN GANGGUAN KEBUTUHAN KEAMANAN DAN PROTEKSI PADAPASIEN DEMAMTYPHOID DI RUMAH SAKIT TK IV 02.07.04 DENKESYAH LAMPUNG TAHUN 2022. Diploma thesis, Poltekkes Tanjungkarang.

Sari, Febri Wita (2022) ASUHAN KEPERAWATAN DENGAN BERSIHAN JALAN NAPAS PADA KASUS KEJANG DEMAM TERHADAP An.A DIRUANG EDELWEIS RSU HANDAYANI KOTABUMI LAMPUNG UTARA TANGGAL 21-23 FEBRUARI 2022. Diploma thesis, Poltekkes Tanjungkarang.

Sari, Merita (2022) ASUHAN KEPERAWATAN GERONTIK DENGAN GANGGUAN KEBUTUHAN RASA AMAN NYAMAN PADA KASUS GOUT ARTRHITIS TERHADAP Ny. S DI DESA BANDAR PUTIH KECAMATAN KOTABUMI SELATAN KABUPATEN LAMPUNG UTARA TANGGAL 21-23 FEBRUARI 2022. Diploma thesis, Poltekkes Tanjungkarang.

Sari, nela (2021) ASUHAN KEPERAWATAN DENGAN GANGGUAN KEBUTUHAN KEAMANAN DAN PROTEKSI : INTEGRITAS KULIT/ JARINGAN PADA KASUS ULKUS DIABETIKUM TERHADAP Tn. K DI RUANG BEDAH RSD MAYJEND HM RYACUDU KOTABUMI LAMPUNG UTARA TANGGAL 08 – 10 MARET 2021. Diploma thesis, Poltekkes tanjungkarang.

Sari, nita purnama (2021) ASUHAN KEPERAWATAN KELUARGA TERHADAP Ny. D DENGAN NYERI AKUT PADA KASUS DISPEPSIA DESA MULANG MAYA KEC. KOTABUMI SELATAN KABUPATEN LAMPUNG UTARA TANGGAL 23-27 MARET 2021. Diploma thesis, Poltekkes tanjungkarang.

Sarlinda, Febrina and Hasan, Amrul and Ulma, Zeni (2022) TURNITIN : Pengaruh Penambahan Serat Kulit Kopi dan Polivinil Alkohol (PVA) terhadap Karakteristik Biodegradable Foam dari Pati Kulit Singkong. Diploma thesis, Poltekkes Tanjungkarang.

Satria Dwi Prasetio, Prasetio Dwi Satria (2022) LAPORAN TUGAS AKHIR ASUHAN KEPERAWATAN GERONTIK DENGAN GANGGUAN NUTRISI DAN CAIRAN TERHADAP TN. P PADA KASUS DIABETES MELITUS TIPE I DI WILAYAH KERJA PUSKESMAS KOTABUMI II LAMPUNG UTARA 25-27 MEI 2022. Diploma thesis, Poltekkes Tanjungkarang.

Savitri, Anjar Rahayu (2022) ASUHAN KEPERAWATAN PASIEN DENGAN GANGGUAN KEBUTUHAN RASA NYAMAN PADA KASUS POST OPERASI MIOMA UTERI TERHADAP Ny.S DI RUANG KEBIDANAN RSU HANDAYANI KOTABUMI LAMPUNG UTARATANGGAL 21-25 FEBRUARI 2022. Diploma thesis, Poltekkes Tanjungkarang.

Senastri, Fidria Ayu (2022) ASUHAN KEPERAWATAN PASIEN DENGAN GANGGUAN KEBUTUHAN OKSIGENASI PADA KASUS ASMA BRONCHIALE TERHADAP Tn.T DI RUANG INSTALASI GAWAT DARURAT RSU HANDAYANI KOTABUMILAMPUNG UTARA TANGGAL 12 NOVEMBER 2021. Diploma thesis, Poltekkes Tanjungkarang.

Sepriza FH, Ferriyal (2022) ASUHAN KEPERAWATAN PERIOPERATIF PADA PASIEN HERNIA INGUINALIS LATERAL DEXTRA DENGAN TINDAKAN HERNIOTOMY DI RUANG OPERASI RUMAH SAKIT BHAYANGKARA POLDA LAMPUNG TAHUN 2022. Diploma thesis, Poltekkes Tanjungkarang.

Shafira, Nabilla (2021) ASUHAN KEPERAWATAN GANGGUAN KEBUTUHAN NUTRISI: OBESITAS PADA KELUARGA BAPAK U KHUSUSNYA PADA IBU F DENGAN TAHAP PERKEMBANGAN PASANGAN BARU DI SUKABUMI, BANDAR LAMPUNG. Diploma thesis, Poltekkes Tanjungkarang.

Shavira, Fitri Aulia (2022) ASUHAN KEPERAWATAN MATERNITAS DENGAN GANGGUAN RASA AMAN NYAMAN PADA KASUS POST SECTIO CAESAREA TERHADAP NY.I DI RUANG KEBIDANAN RSU HANDAYANI KOTABUMI LAMPUNG UTARA TANGGAL 3-5 MARET 2022. Diploma thesis, Poltekkes Tanjungkarang.

Sholekha, Kanti (2022) ASUHAN KEPERAWATAN PASIEN DENGAN KETIDAKSTABILAN KADAR GLUKOSA DARAH PADA KASUS DIABETES MELITUS TERHADAP NY.M DI RUANG FRESIA RSU HANDAYANIKOTABUMILAMPUNG UTARA TANGGAL 17-19 NOVEMBER 2021. Diploma thesis, Poltekkes Tanjungkarang.

Sono, Sono and Apriyani, Heni (2020) BACK MASSAGE WITH OLIVE OIL IMPROVE SLEEP QUALITY ON POST OPERATIVE PATIENT. Diploma thesis, Poltekkes Tanjungkarag.

Sri wahyuni, Endang (2021) Pengaruh Suplementasi Fe dan Vitamin C terhadap Hemoglobin dan Indeks Eritrosit Remaja Putri. Diploma thesis, Poltekkes Tanjung Karang.

Sri wahyuni, Endang and Endarti, Siti (2019) HUBUNGAN KARAKTERISTIK, PENGETAHUAN TENTANG ASUPAN NATRIUM DAN CAIRAN DENGAN INTERDIALYTIC WEIGHT GAIN (IDWG) PADA PENDERITA GAGAL GINJAL KRONIK YANG MENJALANI HEMODIALISIS (HD). Diploma thesis, Poltekkes Tanjung Karang.

Suarni, Lisa and Fitarina, Fitarina and Aliyanto, Warjidin (2020) Faktor yang Berpengaruh pada Perilaku Seksual Remaja di Perkotaan dan Pedesaan. Diploma thesis, Poltekkes Tanjungkarang.

Suarni, Lisa and Trisna, Efa and Apriyani, Heni and Aristoteteles, Aristoteteles (2021) HAKI : Aplikasi Sistem Pakar Proses Keperawatan Berbasis Android Untuk Pembelajaran Mahasiswa Keperawatan. Diploma thesis, Poltekkes Tanjungkarag.

Subakti, Nanda Ayu (2022) ASUHAN KEPERAWATAN GAWAT DARURAT PASIEN DENGAN GANGGUAN OKSIGENASI PADA KASUS EFUSIPLEURATERHADAP Tn. S DI RUANG IGD RSUDJENDERAL AHMAD YANI METRO TANGGAL 08 NOVEMBER 2021. Diploma thesis, Poltekkes Tanjungkarang.

Suci, Silviana Dea (2022) ASUHAN KEPERAWATAN KELUARGA TERHADAP NY.S DENGAN GANGGUAN AMAN DAN NYAMAN PADA KASUS HIPERTENSI DI WILAYAH KERJA PUSKESMAS KOTABUMI II DI DESA BANDAR PUTIH KECAMATAN KOTABUMI SELATAN KABUPATEN LAMPUNG UTARA TANGGAL 21¬-23 FEBRUARI 2022. Diploma thesis, Poltekkes Tanjungkarang.

Sudarmi, Sudarmi and Bertalina, Bertalina and Aprina, Aprina (2020) Efektifitas penerapan interprofessional education-collaborative practice (IPE–CP) tentang gizi seimbang terhadap pengetahuan dan sikap ibu hamil. Diploma thesis, Poltekkes Tanjungkarang.

Sudarmi, Sudarmi and Bertalina, Bertalina and Aprina, Aprina (2020) KORESPONDENSI : Efektifitas penerapan interprofessional education-collaborative practice (IPE–CP) tentang gizi seimbang terhadap pengetahuan dan sikap ibu hamil. Diploma thesis, Poltekkes Tanjungkarag.

Sudarmi, Sudarmi and Bertalina, Bertalina and Aprina, Aprina (2020) LAIK ETIK : Efektifitas penerapan interprofessional education-collaborative practice (IPE–CP) tentang gizi seimbang terhadap pengetahuan dan sikap ibu hamil. Diploma thesis, Poltekkes Tanjungkarag.

Sudarmi, Sudarmi and Bertalina, Bertalina and Aprina, Aprina (2020) TURNITIN : Efektifitas penerapan interprofessional education-collaborative practice (IPE–CP) tentang gizi seimbang terhadap pengetahuan dan sikap ibu hamil. Diploma thesis, Poltekkes Tanjungkarag.

Sumardilah, Dewi Sri and Astuti, Retno Pudji and Aprina, Aprina (2022) KORESPONDENSI: The Influence of Pre-Marriage Class on Knowledge of Bride and Groom in Prevention of Stunting Toddlers. Diploma thesis, Poltekkes Tanjungkarag.

Sumardilah, Dewi Sri and Hasan, Amrul and Gunawan, Tata Asep (2018) Factors Affecting the Central Obesity (Pot Belly) Risk in State Attorney Office. Diploma thesis, Poltekkes Tanjungkarang.

Sumardilah, Dewi Sri and Hastuti, Retno Puji and Aprina, Aprina (2022) The Influence of Pre-Marriage Class on Knowledge of Bride and Groom in Prevention of Stunting Toddlers. Diploma thesis, Poltekkes Tanjungkarang.

Sumardilah, Dewi Sri and Hastuti, Retno Puji and Aprina, Aprina (2022) The Influence of Pre-Marriage Class on Knowledge of Bride and Groom in Prevention of Stunting Toddlers. Diploma thesis, Poltekkes Tanjungkarang.

Sumardilah, Dewi Sri and Hastuti, Retno Puji and Aprina, Aprina (2022) LAIK ETIK: The Influence of Pre-Marriage Class on Knowledge of Bride and Groom in Prevention of Stunting Toddlers. Diploma thesis, Poltekkes Tanjungkarag.

Sumardilah, Dewi Sri and Hastuti, Retno Puji and Aprina, Aprina (2022) TURNITINE : The Influence of Pre-Marriage Class on Knowledge of Bride and Groom in Prevention of Stunting Toddlers. Diploma thesis, Poltekkes Tanjungkarag.

Sumardilah, Dewi Sri and lupiana, Mindo and Aprina, Aprina (2021) The Effect of Demonstration in Preparing a Nutritious Food Menu on Nutrition Consumption Patterns of Pregnant Women. Diploma thesis, Poltekkes Tanjungkarang.

Sumardilah, Dewi Sri and lupiana, Mindo and Aprina, Aprina (2021) The Effect of Demonstration in Preparing a Nutritious Food Menu on Nutrition Consumption Patterns of Pregnant Women. Diploma thesis, Poltekkes Tanjungkarang.

Sumardilah, Dewi Sri and lupiana, Mindo and Aprina, Aprina (2021) KORESPONDENSI : The Effect of Demonstration in Preparing a Nutritious Food Menu on Nutrition Consumption Patterns of Pregnant Women. Diploma thesis, Poltekkes Tanjungkarag.

Sumardilah, Dewi Sri and lupiana, Mindo and Aprina, Aprina (2021) LAIK ETIK : The Effect of Demonstration in Preparing a Nutritious Food Menu on Nutrition Consumption Patterns of Pregnant Women. Diploma thesis, Poltekkes Tanjungkarag.

Sumardilah, Dewi Sri and lupiana, Mindo and Aprina, Aprina (2021) TURNITIN : The Effect of Demonstration in Preparing a Nutritious Food Menu on Nutrition Consumption Patterns of Pregnant Women. Diploma thesis, Poltekkes Tanjungkarag.

Sumiyati, Sumiyati (2021) ANALISIS PENGETAHUAN IBU TENTANG GIZI BALITA DENGAN PERTUMBUHAN BALITA. Diploma thesis, Poltekkes Tanjungkarang.

Sumiyati, Sumiyati (2015) HUBUNGAN JENIS KELAMIN DAN STATUS IMUNISASI DPT DENGAN PNEUMONIA PADA BAYI USIA 0-12 BULAN. Diploma thesis, Poltekkes Tanjungkarang.

Sumiyati, Sumiyati (2016) HUBUNGAN PEMBERIAN ASI DENGAN KEJADIAN PNEUMONIA PADA BALITA USIA 7-24 BULAN DI WILAYAH KERJA PUSKESMAS METRO UTARA. Diploma thesis, Poltekkes Tanjungkarang.

Sunyi Rahma Sari, Sari Sunyi Rahma (2022) ASUHAN KEPERAWATAN GAWAT DARURAT PASIEN DENGAN GANGGUAN KEBUTUHAN SIRKULASI PADA KASUS CEDERA KEPALA BERAT TERHADAP TN. D DI INSTALASI GAWAT DARURAT RSUD JENDRAL AHMAD YANI METRO LAMPUNG 29 NOVEMBER 2021. Diploma thesis, Poltekkes Tanjungkarang.

Swastika, Erlin Puja (2022) ASUHAN KEPERAWATAN PASIENDENGAN GANGGUAN SIRKULASI PADA KASUS PERDARAHAN UTERUS ABNORMAL (PUA)TERHADAP Ny. NDI RUANG KEBIDANAN RSU HANDAYANI KOTABUMI LAMPUNG UTARATANGGAL 28FEBRUARI – 02MARET 2022. Diploma thesis, Poltekkes Tanjungkarang.

sartika, nita (2021) ASUHAN KEPERAWATAN PASIEN DENGAN GANGGUAN KEBUTUHAN RASA AMAN NYAMAN: NYERI AKUT PADA KASUS POSTOPERASI TUMOR PAYUDARA TERHADAP Nn.M DI RUANG FRESIA LANTAI III RS HANDAYANI KOTABUMI LAMPUNG UTARA TANGGAL 11-13 MARET 2020. Diploma thesis, Poltekkes tanjungkarang.

sulastri, sulastri (2018) Kemampuan Keluarga dalam Merawat Orang dengan Gangguan Jiwa. Diploma thesis, Poltekkes Tanjungkarang.

sulastri, sulastri (2018) Kemampuan Keluarga dalam Merawat Orang dengan Gangguan Jiwa. Diploma thesis, Poltekkes Tanjungkarang.

sulastri, sulastri and Ira Cahyanti, ade and rahmayati, el (2019) Perilaku Caring menurunkan Kecemasan Pasien Preoperasi. Diploma thesis, Poltekkes Tanjungkarang.

sulastri, sulastri and Ira Cahyanti, ade and rahmayati, el (2019) Perilaku Caring menurunkan Kecemasan Pasien Preoperasi. Diploma thesis, Poltekkes Tanjungkarang.

sulastri, sulastri and Murhan, Al (2019) Konflik Peran Ganda terhadap Tingkat Stres Kerja Polisi Wanita Di Polres Lampung Utara. Diploma thesis, Poltekkes Tanjungkarang.

sulastri, sulastri and Murhan, Al (2019) Konflik Peran Ganda terhadap Tingkat Stres Kerja Polisi Wanita Di Polres Lampung Utara. Diploma thesis, Poltekkes Tanjungkarang.

sulastri, sulastri and Yuniar sari, Niken (2018) Metode Pendokumentasian Elektronik dalam Meningkatkan Kualitas Pelayanan Keperawatan. Diploma thesis, Poltekkes Tanjungkarang.

sulastri, sulastri and fatonah, siti and amperaningsih, yuliati and Suarni, Lisa (2020) psychological treatment after the tsunami disaster. Diploma thesis, Poltekkes Tanjungkarang.

sulastri, sulastri and kartika, yeyen (2016) Psikoedukasi Keluarga Meningkatkan Kepatuhan Minum Obat ODGJ di Puskesmas Kedaton Bandar Lampung. Diploma thesis, Poltekkes Tanjungkarang.

sulastri, sulastri and rohayati, rohayati and febriaty, sary (2021) Bermain Buku Pop-Up sebagai Terapi Gangguan Mental Emosional Pasca Bencana Tsunami. Diploma thesis, Poltekkes Tanjungkarang.

sulastri, sulastri and rohayati, rohayati and febriaty, sary (2021) Bermain Buku Pop-Up sebagai Terapi Gangguan Mental Emosional Pasca Bencana Tsunami. Diploma thesis, Poltekkes Tanjungkarang.

sulastri, sulastri and saiful kohir, dedek (2020) The Effects of Family Support on Elderly Mental Development. Diploma thesis, Poltekkes Tanjungkarang.

sulastri, sulastri and sari, yuniar (2018) Metode Pendokumentasian Elektronik dalam Meningkatkan Kualitas Pelayanan Keperawatan. Diploma thesis, Poltekkes Tanjungkarang.

syahidah, salsabila (2021) ASUHAN KEPERAWATAN PASIEN DENGAN GANGGUAN KEBUTUHAN SIRKULASI PADA KASUS THALASEMIA TERHADAP AN.H DI RUANG ANAK RSUD MAYJEND HM RYACUDU KOTABUMI LAMPUNG UTARA TANGGAL 11 MARET 2021. Diploma thesis, Poltekkes tanjungkarang.

T

TAMARA, RINDI YANTI (2023) ASUHAN KEPERAWATAN GANGGUAN KEBUTUHAN AKTIVITAS PADA PASIEN DENGAN SPACE OCCUPYING LESSION (SOL) DAN STROKE INFARK DI RUANG BOUGENVIL RSUD DR. H. ABDUL MOELOEK PROVINSI LAMPUNG TAHUN 2023. Diploma thesis, Poltekkes KemenkesTanjungkarang.

TANIA, SERLI ERA (2023) PERBEDAAN PENYEMBUHAN LUKA MENGGUNAKAN BALUTAN TRANSPARAN FILM DENGAN BALUTAN KONVENSIONAL PADA LUKA PASIEN POST SECTIO CAESAREA DI RSUD Dr. H. ABDUL MOELOEK PROVINSI LAMPUNG. Diploma thesis, Poltekkes KemenkesTanjungkarang.

TAUFIQURRAHMAN, BAGAS (2023) ASUHAN KEPERAWATAN GANGGUAN PEMENUHAN KEBUTUHAN AKTIVITAS DAN ISTIRAHAT PADA PASIEN ASAM URAT DI DESA SRIMULYO 1 PEMANGGILAN NATARLAMPUNG SELATAN TAHUN 2023. Diploma thesis, Poltekkes KemenkesTanjungkarang.

THAYYIBAH, ANNISA (2020) ASUHAN KEPERAWATAN GANGGUAN KEBUTUHAN AKTIVITAS PADA PASIEN STROKE HEMORAGIK DI RUANG BOUGENVILLE RSUD Dr. H. ABDUL MOELOEK PROVINSI LAMPUNG TAHUN 2020. Diploma thesis, Poltekkes Tanjungkarang.

TIRTA, ADITYA PRIMA (2021) ASUHAN KEPERAWATAN KELUARGA TERHADAP Ny. R DENGAN GANGGUAN NUTRISI PADA KASUS DIABETES MELITUS TIPE 2 DI KEL. TANJUNG AMAN KEC. KOTABUMI SELATAN KABUPATEN LAMPUNG UTARA TANGGAL 24-26 MARET 2021. Diploma thesis, Poltekkes Tanjungkarang.

TITIASA, DAVID AULIA (2022) ASUHAN KEPERAWATAN GANGGUAN KEBUTUHAN NYAMAN NYERI PADA Ny. S DENGAN DIAGNOSA MEDIS CEDERA KEPALA SEDANG DI RUANG ICU RUMAH SAKIT Dr. A. DADI TJOKRODIPO BANDAR LAMPUNG TAHUN 2022. Diploma thesis, Poltekkes Tanjungkarang.

TOGATOROP, VIA ELIADORA (2020) ASUHAN KEPERAWATAN PERIOPERATIF PADA PASIEN PERITONITIS DENGAN TINDAKAN LAPARATOMI DI RUANG OK RUMAH SAKIT AIRAN RAYA LAMPUNG SELATAN TAHUN 2020. Diploma thesis, Poltekkes Tanjungkarang.

TOMI, TOMI (2020) ASUHAN KEPERAWATAN PERIOPERATIF PADA PASIEN ILEUS OBSTRUKTIF DENGAN TINDAKAN LAPAROTOMI DIRUANG OK RSUD JEND.AHMAD YANI METRO TAHUN 2019. Diploma thesis, Poltekkes Tanjungkarang.

TRAMANSYAH, RAHMAT (2020) ASUHAN KEPERAWATAN PERIOPERATIF PADA PASIEN MALL UNION FRAKTUR DENGAN TINDAKAN AFF PLATE DAN SCREW DI RUANG BEDAH RS. DKT PROVINSI LAMPUNG TAHUN 2019. Diploma thesis, Poltekkes Tanjungkarang.

TRIANISA, MULYA (2023) PENGARUH TERAPI BERMAIN COLORING CLAY TERHADAP PENURUNAN KECEMASAN HOSPITALISASI PADA ANAK PRA SEKOLAH DI RUANG RAWAT BEDAH ANAK RSUD DR. H. ABDUL MOELOEK TAHUN 2023. Diploma thesis, Poltekkes KemenkesTanjungkarang.

TRIYONO, OLVA NUGRAHEMI (2023) HUBUNGAN DUKUNGAN SOSIAL TERHADAP TERJADINYA POST PARTUM BLUES PADA PASIEN POST OPERASI SECTIO CAESAREA DI RSIA ANUGERAH MEDICAL CENTER KOTA METRO TAHUN 2023. Diploma thesis, Poltekkes KemenkesTanjungkarang.

Talitha, Wynne Ardelia and Sumiyati, Sumiyati and Islamiyati, Islamiyati (2017) HUBUNGAN USIA IBU BERSALIN DAN PREEKLAMPSIA KEHAMILAN DENGAN KEJADIAN BERAT BAYI LAHIR RENDAH DI RUANG KEBIDANAN RUMAH SAKIT UMUM DAERAH BOBBAZAR, SKM KALIANDA. Diploma thesis, Poltekkes Tanjungkarang.

Taufik, Muhammad (2021) ASUHAN KEPERAWATAN GANGGUAN KEBUTUHAN NYERI AKUT PADA REMAJA KELUARGA BAPAK F DENGAN GASTRITIS DI KEC. TANJUNG KARANG PUSAT KOTA BANDAR LAMPUNG TAHUN 2021. Diploma thesis, Poltekkes Tanjungkarang.

Taufiq, Ihsan and Apriyani, Heni (2021) HAKI : Video Latihan Progressive Muscle Relaxation Dengan Musik Daerah Dalam Menurunkan Kadar Gula Darah Penderita DM Tipe 2. Diploma thesis, Poltekkes Tanjungkarag.

Tiara, Bunga Indah (2021) ASUHAN KEPERAWATAN PASIEN DENGAN GANGGUAN KEBUTUHAN SIRKULASI PADA KASUS THALASEMIA TERHADAP AN. A DI RUANG ANAK RSU HANDAYANI KOTABUMI LAMPUNG UTARA TANGGAL 8-9 MARET 2021. Diploma thesis, Poltekkes tanjungkarang.

Tijayanti, Meri (2022) ASUHAN KEPERAWATAN PASIEN DENGAN GANGGUAN KEBUTUHAN ISTIRAHAT DAN TIDUR PADA KASUS POST SECTIO CAESAREA TERHADAP Ny. T DI RUANG KEBIDANAN RSU HANDAYANI KOTABUMI LAMPUNG UTARA TANGGAL 28 FEBRUARI – 02 MARET 2022. Diploma thesis, Poltekkes Tanjungkarang.

Tri Retno Suryani Wulan, Wulan Tri Retno Suryani (2022) ASUHAN KEPERAWATAN PASIEN DENGAN GANGGUAN KEBUTUHAN NUTRISI PADA KASUS DIABETES MELITUS TIPE 2 TERHADAP Ny. N DI DESA KARANG AGUNG KOTABUMI SELATAN LAMPUNG UTARA TANGGAL 1-3 MARET 2022. Diploma thesis, Poltekkes Tanjungkarang.

Trigunarso, Sri Indra and Fikri, Ahmad and Santoso, Budi (2022) INCRIMINATION AND BLOOD FEEDING ON MOLECULAR MALARIA VECTORS IN PESAWARAN DISTRICT, LAMPUNG PROVINCE. Diploma thesis, Poltekkes Tanjungkarang.

Trigunarso, Sri Indra and Muslim, Zainal and Helmi, Helina and Riyanto, Riyanto (2022) Sistem Informasi Pemantauan Pengobatan Pasien TB Paru (SISFOTBPARU) Berbasis Android Gateway. Diploma thesis, Poltekkes Tanjungkarang.

Trigunarso, Sri Indra and Muslim, Zainal and Helmy, Heina (2022) PENGARUH PENDAPATAN DAN PENGETAHUAN SERTA LINGKUNGAN TERHADAP KEJADIAN TUBERKULOSIS PARU DI KOTA BANDAR LAMPUNG DENGAN PENDEKATAN STRUCTURAL EQUESTION MODELING (SEM). Diploma thesis, Poltekkes Tanjungkarang.

Trigunarso, Sri Indra and Muslim, Zainal and Helmy, Helina and Riyanto, Riyanto (2022) Sistem Informasi Pemantauan Pengobatan Pasien TB Paru (SISFOTBPARU) Berbasis Android Gateway. Diploma thesis, Poltekkes Tanjungkarang.

Trigunarso, Sri Indra and Purbianto, Purbianto and Agustanti, Dwi (2022) The Community’s Preparation in Facing the Outbreak of Covid-19 Pandemic in Lampung Province. Diploma thesis, Poltekkes Tanjungkarang.

Trigunarso, Sri Indra and Yushananta, Prayudhy and Ainin, Fernanda Kurnun (2018) Kadar Debu terhadap Kapasitas Vital Paru pada Masyarakat di Sekitar PT Semen Baturaja. Diploma thesis, Poltekkes Tanjungkarang.

Trigunarso, Sri Indra and Yushananta, Prayudhy and Ainin, Fernanda Kurnun (2018) Kadar Debu terhadap Kapasitas Vital Paru pada Masyarakat di Sekitar PT Semen Baturaja. Diploma thesis, Poltekkes Tanjungkarang.

U

UMAIROH, UMAIROH (2023) ASUHAN KEPERAWATAN GANGGUAN RASA NYAMAN PADA KASUS DISPEPSIA TERHADAP NY.N DI RUANG PENYAKIT DALAM RSD MAYJEND HM RYACUDU KOTABUMI LAMPUNG UTARA TANGGAL 7 – 9 NOVEMBER 2022. Diploma thesis, Poltekkes Kemenkes Tanjungkarang.

UMAKA, AMI (2021) ASUHAN KEPERAWATAN GANGGUAN NYERI KRONIS PADA IBU R KELUARGA BAPAK S DENGAN GOUT ARTHRITIS DI DESA TANJUNG SENENG KECAMATAN KOTABUMI SELATAN LAMPUNG UTARA TAHUN 2021. Diploma thesis, Poltekkes Tanjungkarang.

UMAYYAH, SITI (2023) PENGARUH KOMBINASI TEKHNIK DISTRAKSI AUDIOVISUAL DAN AROMATERAPI LAVENDER TERHADAP PENURUNAN NYERI PASIEN PASCA BEDAH DENGAN GENERAL ANESTESI DI RSUD DR. H. ABDUL MOELOEK PROVINSI LAMPUNG TAHUN 2023. Diploma thesis, Poltekkes KemenkesTanjungkarang.

UMAYYAH, SITI (2023) PENGARUH KOMBINASI TEKHNIK DISTRAKSI AUDIOVISUAL DAN AROMATERAPI LAVENDER TERHADAP PENURUNAN NYERI PASIEN PASCA BEDAH DENGAN GENERAL ANESTESI DI RSUD DR. H. ABDUL MOELOEK PROVINSI LAMPUNG TAHUN 2023. Diploma thesis, Poltekkes KemenkesTanjungkarang.

USMAN, MENTARI ANGGERAINI (2021) ASUHAN KEPERAWATAN GANGGUAN KEBUTUHAN RASA NYAMAN PADA REMAJA An.R KELUARGA BAPAK J DENGAN DISMENOREA DI DESA TERBANGGI BESAR KABUPATEN LAMPUNG TENGAH TAHUN 2021. Diploma thesis, Poltekkes Tanjungkarang.

UTAMA, PUTRI (2021) ASUHAN KEPERAWATAN GANGGUAN KEBUTUHAN RASA NYAMAN NYERI PADA KELUARGA Tn.S KHUSUSNYA Ny.U DENGAN GOUT ARTRITIS DI DESA PEMERIHAN KECAMATAN KRUI SELATAN KABUPATEN PESISIR BARAT PROVINSI LAMPUNG TAHUN 2021. Diploma thesis, Poltekkes Tanjungkarang.

UTAMA, RIZQO ADITYA (2020) HUBUNGAN FREKUENSI MENYUSUI DENGAN INVOLUSI UTERUS PADA IBU POST SECTIO CAESAREA DI RSIA RESTU BUNDA KOTA BANDAR LAMPUNG TAHUN 2020. Diploma thesis, Poltekkes Tanjungkarang.

UTAMI, FADHILA HERYA (2021) ASUHAN KEPERAWATAN KELUARGA Tn. Y GANGGUAN PEMENUHAN RASA NYAMAN NYERI KHUSUSNYA Nn. C PADA TAHAP REMAJA DENGAN DYSMENORRHEA DI SAWAH BREBES TANJUNG KARANG TIMUR BANDAR LAMPUNG TAHUN 2021. Diploma thesis, Poltekkes Tanjungkarang.

UTAMI, FEMY LIA (2021) ASUHAN KEPERAWATAN PERIOPERATIF LAPAROTOMI EXPLORASI PADA P A S I E N A P P E N D I C I T I S DI RSUD H. BOB BAZAR KALIANDA TAHUN 2021. Diploma thesis, Poltekkes Tanjungkarang.

UTAMI, ZARNI (2022) ASUHAN KEPERAWATAN GANGGUAN KEBUTUHAN OKSIGENASI PADA PASIEN CONGESTIVE HEART FAILURE DI RUANG JANTUNG RSUD JENDRAL AHMAD YANI METRO TAHUN 2022. Diploma thesis, Poltekkes Tanjungkarang.

V

VALENTINE, TARISA (2022) GAMBARAN FAKTOR RISIKO BATU SALURAN KEMIH PADA PASIEN DENGAN DIAGNOSA BATU SALURAN KEMIH DI POLIKLINIK UROLOGI DI RSUD Dr. H. ABDUL MOELOEK PROVINSI LAMPUNG TAHUN 2022. Diploma thesis, Poltekkes Tanjungkarang.

VALENTINE, TARISA (2023) PENERAPAN TEKNIK RELAKSASI OTOT PROGRESIF PADAPASIEN NEFROLITIASIS POST OPNEFROLITOTOMI DENGANMASALAHKEPERAWATANNYERIDI RUMAH SAKITMARDIWALUYOMETRO TAHUN2023. Diploma thesis, Poltekkes Kemenkes Tanjungkarang.

VANIAR, LOVI (2023) ASUHAN KEPERAWATAN NYERI AKUT PADA PASIEN POST OP MASTEKTOMI DENGAN INTERVENSI TARIK NAFAS DALAM KOMBINASI GENGGAM JARI DI RUANG BEDAH MAWAR RUMAH SAKIT ABDUL MOELOEK PROVINSI LAMPUNG TAHUN 2023. Diploma thesis, Poltekkes Kemenkes Tanjungkarang.

VARADILLA, FIA (2022) ASUHAN KEPERAWATANGANGGUAN OKSIGENASI PADA PASIEN PENYAKIT PARU OBSTRUKSI KRONIKDI RUANG PARU RSUD JENDERAL AHMAD YANI PROVINSI LAMPUNG TAHUN 2022. Diploma thesis, Poltekkes Tanjungkarang.

VENIYA, RAHMATIN (2021) ASUHAN KEPERAWATAN GANGGUAN PEMENUHAN KEBUTUHAN RASA NYAMAN PADA AN.L KELUARGA BAPAK I DENGAN KEJADIAN KEPUTIHAN DI DESA WAY GALIH KECAMATAN TANJUNG BINTANG KABUPATEN LAMPUNG SELATAN TAHUN 2021. Diploma thesis, Poltekkes Tanjungkarang.

VERONICA, ALMA (2023) IMPLEMENTASI EDUKASI PERAWATAN LUKA PADA PASIEN DENGAN HIPERGLIKEMIA POST OPERASI AMPUTASI DI RS MARDI WALUYO METRO. Diploma thesis, Poltekkes Kemenkes Tanjungkarang.

VERONICA, MEILANI (2021) ASUHAN KEPERAWATAN PASIEN DENGAN GANGGUAN AMAN DAN NYAMAN TERHADAP Ny. YPADA KASUS HIPERTENSI DI KEL. TANJUNG AMAN KEC. KOTABUMI SELATAN TANGGAL 22-25 MARET 2021. Diploma thesis, Poltekkes Tanjungkarang.

VINOLIA, MONICA (2021) GAMBARAN NILAI LAJU ENDAP DARAH DAN C-REACTIVE PROTEIN PADA PENDERITA DIABETES MELLITUS TIPE 2 (STUDI PUSTAKA). Diploma thesis, Poltekkes Tanjungkarang.

VIVINARTI, SEFTIA (2022) ASUHAN KEPERAWATAN PERIOPERATIF PADA PASIEN CLOSE FRAKTUR FEMUR ⅓ DISTAL DEXTRA DENGAN TINDAKAN OPERASI ORIF DI RUMAH SAKIT BHAYANGKARA POLDA LAMPUNG TAHUN 2022. Diploma thesis, Poltekkes Tanjungkarang.

W

WAHYUDHA, WAHYUDHA (2022) ASUHAN KEPERAWATAN PERIOPERATIF PADA PASIEN BATU URETER DENGAN TINDAKAN URETROLITOTOMI DEXTRA DI RUMAH SAKIT UMUM DAERAH Dr.H. ABDUL MOELOEK PROVINSI LAMPUNG TAHUN 2022. Diploma thesis, Poltekkes Tanjungkarang.

WAHYUDI, FAJAR DESMA (2023) ANALISIS SURVIVAL PENDERITA COVID-19 DI PROPINSI LAMPUNG TAHUN 2021. Masters thesis, Poltekkes Kemenkes Tanjungkarang.

WAHYUNI, SRI (2023) ASUHAN KEPERAWATAN GANGGUAN KEBUTUHAN RASA NYAMAN (NYERI AKUT) PADA PASIEN POST OPERASI FRAKTUR TIBIA FIBULA SINISTRA DAN FRAKTUR TIBIA DEXTRA DI RUANG BEDAH RUMAH SAKIT DR. A. DADI. TJOKRODIPO BANDAR LAMPUNG TAHUN 2023. Diploma thesis, Poltekkes KemenkesTanjungkarang.

WANDIRA, AYU (2021) ASUHAN KEPERAWATAN GAWAT DARURAT GANGGUAN KEBUTUHAN OKSIGENASI PADA Tn.K DENGAN KASUS ASMA BRONKHIAL DI INSTALASI GAWAT DARURAT RSUD JEND AHMAD YANI METRO TANGGAL 29 MARET 2021. Diploma thesis, Poltekkes Tanjungkarang.

WANDIRA, ESTI (2023) ASUHAN KEPERAWATAN GANGGUAN PEMENUHAN KEBUTUHAN RASA NYAMAN PADA PASIEN HIPERTENSI DESA SRIMULYO 1 RT 3 PEMANGGILAN KECAMATANNATAR KABUPATEN LAMPUNG SELATAN. Diploma thesis, Poltekkes KemenkesTanjungkarang.

WANVILLYOV, SHAGGY NATASHA (2023) ASUHAN KEPERAWATAN KELUARGA DENGAN GANGGUAN KEBUTUHAN NUTRISI PADA KASUS DIABETES MELLITUS TERHADAP Tn. E DI KELURAHAN KOTA ALAM WILAYAH KERJA PUSKESMAS KOTABUMI II TANGGAL 29-31 MARET 2023. Diploma thesis, Poltekkes Kemenkes Tanjungkarang.

WARDHANA, MADE KRISNA (2023) ASUHAN KEPERAWATAN GAWAT DARURAT DENGAN GANGGUAN KEBUTUHAN OKSIGENASI PADA KASUS STROKE HEMORAGIK TERHADAP NY. E DI IGD RSU HANDAYANI KOTABUMI LAMPUNG UTARA TANGGAL 25 NOVEMBER 2022. Diploma thesis, Poltekkes Kemenkes Tanjungkarang.

WARDIYAH, ZAHRATUL (2020) ASUHAN KEBIDANAN TUMBUH KEMBANG TERHADAP An. Y DENGAN KETERLAMBATAN PERKEMBANGAN MOTORIK HALUS DAN SOSIAL KEMANDIRIAN DI PM PMB PONIRAH, S.ST METRO. Diploma thesis, Poltekkes Tanjungkarang.

WATI, AGUSTINA PRABA (2023) ASUHAN KEPERAWATAN PASIEN DENGAN GANGGUAN KEBUTUHAN ISTIRAHAT DAN TIDUR PADA KASUSPOST SECTIO CAESAREA TERHADAP Ny.S DI RUANG KEBIDANAN RSU HANDAYANI KOTABUMI LAMPUNG UTARA TANGGAL 29-31 MARET 2023. Diploma thesis, Poltekkes Kemenkes Tanjungkarang.

WATI, AYU PRATIKA (2021) ASUHAN KEPERAWATAN PERIOPERATIF PADA PASIEN HERNIA INGUINALIS LATERAL DENGAN TINDAKAN HERNIOTOMY DI RUANG OPERASI RSUD DR.H.BOB BAZAR,SKM KALIANDA TAHUN 2021. Diploma thesis, Poltekkes Tanjungkarang.

WATI, AYU PRATIKA (2020) INTERVENSI KEPERAWATAN DALAM MEMBANTU PEMULIHAN PERISTALTIK USUS PADA PASIEN POST OPERASI DI RUANG RAWAT INAP BEDAH. Diploma thesis, Poltekkes Tanjungkarang.

WATI, FERA (2021) ASUHAN KEPERAWATAN GANGGUAN HIPERTERMI PADA ANAK REMAJA R KELUARGA BAPAK N DENGAN DEMAM THYPOID DI KELURAHAN WAY DADI BARU KECEMATAN SUKARAME KOTA BANDAR LAMPUNG TAHUN 2021. Diploma thesis, Poltekkes Tanjungkarang.

WATI, NOVITA INDAH (2021) ASUHAN KEPERAWATAN GERONTIK DENGAN GANGGUANKEBUTUHAN AMAN NYAMAN TERHADAP Ny. D PADA KASUS RHEUMATOID ARTHRITISDI DESA TANJUNG AMAN KEC. KOTABUMI SELATANKABUPATEN LAMPUNG UTARA TANGGAL 23-25 MARET 2021. Diploma thesis, Poltekkes Tanjungkarang.

WATI, PUTRI RAHMA (2022) ASUHAN KEPERAWATAN GANGGUAN ELIMINASI PADA PASIEN DENGAN COLIC ABDOMEN DI RSUD JENDERAL AHMAD YANI KOTA METRO LAMPUNG TAHUN 2022. Diploma thesis, Poltekkes Tanjungkarang.

WATI, SITI WAMROAH LUKMANA (2020) ASUHAN KEPERAWATAN GANGGUAN PEMENUHAN KEBUTUHAN BELAJAR PADA KELUARGA DENGAN KEJADIAN FLUOR ALBUS PADA REMAJA PUTRI DI WILAYAH KERJA PUSKESMAS NATAR LAMPUNG SELATAN TAHUN 2020. Diploma thesis, Poltekkes Tanjungkarang.

WATI, SITIA (2022) ASUHAN KEPERAWATAN KELUARGA DENGAN GANGGUANKEBUTUHAN RASA NYAMAN TERHADAP Ny. L PADA KASUS HIPERTENSI DI DESA TALANG SURABAYA KEC. KOTABUMI SELATAN KABUPATEN LAMPUNG UTARA TANGGAL 21-23 FEBUARI 2022. Diploma thesis, Poltekkes Tanjungkarang.

WENZA, DONI (2020) ASUHAN KEPERAWATAN GANGGUAN KEBUTUHAN NUTRISI PADA PASIEN IBU HAMIL TRIMESTER SATU DENGAN HIPEREMESIS GRAVIDARUM DI PUSKESMAS PANJANG BANDAR LAMPUNG TAHUN 2020. Diploma thesis, Poltekkes Tanjungkarang.

WIBOWO, IKHSAN AJI DWI (2020) PERBEDAAN KECEMASAN PADA ANAK PRE OPERASI YANG DIBERIKAN ART THERAPY BERMAIN PLASTISIN DAN MENEMPEL KOLASE DI RUANG BEDAH ANAK RSUD Dr. H. ABDUL MOELOEK PROVINSI LAMPUNG TAHUN 2020. Diploma thesis, Poltekkes Tanjungkarang.

WIBOWO, RESTU WAHYU (2021) ASUHAN KEPERAWATAN PASIEN DENGAN GANGGUAN KEBUTUHAN AKTIVITAS DAN ISTIRAHAT PADA KASUS STROKE NON HEMORAGIK PADA Tn. H DI RUANG FRESSIA LANTAI III RSU HANDAYANI KOTABUMI LAMPUNG UTARA 12-13 MARET 2021. Diploma thesis, Poltekkes Tanjungkarang.

WICAKSANA, GARIEL FARHAN (2023) HUBUNGAN DUKUNGAN KELUARGA DENGAN TINGKAT KECEMASAN PASIEN PRE SPINAL ANESTESI DI RSUD Dr. H. ABDUL MOELOEK PROVINSI LAMPUNG TAHUN 2022. Diploma thesis, Poltekkes Kemenkes Tanjungkarang.

WIDIANTARI, NI KADEK GALIH (2021) ASUHAN KEPERAWATAN GANGGUAN KEBUTUHAN ELIMINASI ALVI AKIBAT PATOLOGI SISTEM PENCERNAAN DENGAN DIAGNOSA MEDIS HEMOROID INTERNA GRADE II PADA ANGGOTA KELUARGA TN.S DI KAMPUNG BAYUR RAJABASA JAYA BANDAR LAMPUNG TAHUN 2021. Diploma thesis, Poltekkes Tanjungkarang.

WIDIATI, MELINIA EKA (2021) ASUHAN KEPERAWATAN TERHADAP NY. D DENGAN GANGGUAN RASA AMAN NYAMAN PADA KASUS POST OPERASI TUMOR MAMAE DI RUANG MAWAR LANTAI 3 RSU HANDAYANI KOTABUMI LAMPUNG UTARA TANGGAL 08-10 MARET 2021. Diploma thesis, Poltekkes Tanjungkarang.

WIDINI, GALUH (2021) ASUHAN KEPERAWATAN KELUARGA LANSIA DENGAN GANGGUAN PEMENUHAN KEBUTUHAN NYERI AKUT PADA IBU S KELUARGA BAPAK P DENGAN GOUT ARTHRITIS DI DESA PANCASILA KECAMATAN NATAR KABUPATEN LAMPUNG SELATAN TAHUN 2021. Diploma thesis, Poltekkes Tanjungkarang.

WIDIYAWATI, ADHAINI (2021) ASUHAN KEPERAWATAN PERIOPERATIF PASIEN DENGAN DIAGNOSA FRAKTUR KLAVIKULA DENGAN TINDAKAN OPERASI ORIF (OPEN REDUCTION INTERNAL FIXATION) DI RUANG OPERASI RUMAH SAKIT YUKUM MEDICAL CENTRE LAMPUNG TENGAH TAHUN 2021. Diploma thesis, Poltekkes Tanjungkarang.

WIDIYAWATI, ADHAINI (2020) PENGARUH TERAPI MUSIK TERHADAP BOUNDING ATTACHMENT PADA IBU POST SECTIO CAESAREA DI RUMAH SAKIT IBU DAN ANAK RESTU BUNDA BANDAR LAMPUNG TAHUN 2020. Diploma thesis, Poltekkes Tanjungkarang.

WIDIYAWATI, ADHAINI and Manurung, Idawati and Murhan, Al (2020) PENGARUH TERAPI MUSIK TERHADAP BOUNDING ATTACHMENT PADA IBU POST SECTIO CAESAREA. Diploma thesis, Poltekkes Tanjungkarang.

WIDYATAMI, SAFIRA (2022) ASUHAN KEPERAWATAN GANGGUAN KEBUTUHAN OKSIGENASI PADA PASIEN PENYAKIT PARU OBSTRUKSI KRONIK (PPOK) DIRUANG ICU RSUD JENDERAL AHMAD YANI METRO TAHUN 2022. Diploma thesis, Poltekkes Tanjungkarang.

WIGUNA, DWITA TATA (2020) ASUHAN KEPERAWATAN GANGGUAN PEMENUHAN KEBUTUHAN OKSIGENASI DENGAN MASALAH BERSIHAN JALAN NAFAS TIDAK EFEKTIF PADA PASIEN TUBERCULOSIS PARU DI RUANG PARU RSUD. JENDRAL AHMAD YANI METRO TAHUN 2020. Diploma thesis, Poltekkes Tanjungkarang.

WIJAYA, BRAM (2020) ASUHAN KEPERAWATAN PADA PASIEN HERNIA DENGAN TINDAKAN HERNIOTOMI DI RUANG OK RS DKT BANDARLAMPUNG TAHUN 2019. Diploma thesis, Poltekkes Tanjungkarang.

WIJAYA, SASTRA (2022) ASUHAN KEPERAWATAN GANGGUAN KEBUTUHAN OKSIGENASI PADA PASIEN PNEUMONIA DI RSUD. JENDRAL AHMAD YANI METRO PROVINSI LAMPUNG TAHUN 2022. Diploma thesis, Poltekkes Tanjungkarang.

WILANDA, RORI (2021) ASUHAN KEPERAWATAN PERIOPERATIF PADA PASIEN G2P2A0 34 MINGGU DENGAN KETUBAN PECAH DINI DENGAN TINDAKAN SECTIO CAESAREA DI RUANG OPERASI RSUD ALIMUDDIN UMAR LIWA TAHUN 2021. Diploma thesis, Poltekkes Tanjungkarang.

WILANDA, RORI (2020) PENGARUH TEKNIK DISTRAKSI AUDIO VISUAL MENGGUNAKAN MEDIA VIRTUAL REALITY TERHADAP PENURUNAN PERSEPSI NYERI PADA PASIEN POST OPERASI SECTIO CAESAREA DI RSUD ALIMUDDIN UMAR LAMPUNG BARAT PADA TAHUN 2020. Diploma thesis, Poltekkes Tanjungkarang.

WINANGSIH, EIS (2022) ASUHAN KEPERAWATAN PERIOPERATIF PADA PASIEN HERNIA INGUINALIS DEXTRA DENGAN TINDAKAN HERNIOTOMY DI RUMAH SAKIT BHAYANGKARA POLDA LAMPUNG TAHUN 2022. Diploma thesis, Poltekkes Tanjungkarang.

WINDIYASTI, SHINTA (2020) ASUHAN KEPERAWATAN GANGGUAN KEBUTUHAN RESPIRASI PADA PASIEN STROKE DI RUANG BOUGENVILLE RSUD Dr. H. ABDUL MOELOEK PROVINSI LAMPUNG TAHUN 2020. Diploma thesis, Poltekkes Tanjungkarang.

WINDIYASTI, SHINTA (2023) IMPLEMENTASIPERAWATAN LUKA MODERN DRESSING (TRANSPARENT FILM)PADAPASIEN GANGGUAN INTEGRITAS JARINGANPOST OPERATIF APENDIKTOMIDI RSUD DR. H. ABDUL MOELOEK PROVINSI LAMPUNG TAHUN 2023. Diploma thesis, Poltekkes Kemenkes Tanjungkarang.

WINDIYASTI, SHINTA (2023) PENGARUH HEALTH EDUCATION MEDIA YOUTUBE TERHADAP SIKAP MOBILISASI DINI PADA PASIEN POST OPERASI LAPARATOMI DI RSUD DR. H ABDUL MOELOEK PROVINSI LAMPUNG TAHUN 2022. Diploma thesis, Poltekkes KemenkesTanjungkarang.

WIRAWAN, KOMANG (2020) ASUHAN KEPERAWATAN PERIOPERATIF PADA PASIENDENGAN TINDAKAN LAPAROTOMI ATAS INDIKASI TRAUMA TUMPUL ABDOMEN DI RUANG BEDAH RS. AIRAN RAYA LAMPUNG SELATAN PROVINSI LAMPUNG. Diploma thesis, Poltekkes Tanjungkarang.

WULANDARI, AMBAR (2021) ASUHAN KEPERAWATAN GANGGUAN KEBUTUHAN RASA NYAMAN PADA ANAK A KELUARGA BAPAK R DENGAN URTIKARIA DI DESA TAMANSARI KECAMATAN GEDONGTATAAN KABUPATEN PESAWARAN TAHUN 2021. Diploma thesis, Poltekkes Tanjungkarang.

WULANDARI, KIKI (2021) ASUHAN KEPERAWATAN GANGGUAN KEBUTUHAN AKTIVITAS PADA IBU Z DENGAN STROKE NON HEMORAGIK KELUARGA BAPAK N DI PEKON OLOK PANDAN 3 KRUI KABUPATEN PESISIR BARAT TAHUN 2021. Diploma thesis, Poltekkes Tanjungkarang.

WULANDARI, KRISTANTI (2023) PENGARUH TERAPI ZIKIR ASMA’UL HUSNA TERHADAP PENURUNAN INTENSITAS NYERI PASIEN POST OPERASI SECTIO CAESAREA DI RSIA ANUGERAH MEDICAL CENTRE KOTA METRO TAHUN 2023. Diploma thesis, Poltekkes KemenkesTanjungkarang.

WULANDARI, PUPUT (2022) ASUHAN KEPERAWATAN GANGGUAN KEBUTUHAN CAIRAN PADA PASIEN PERDARAHAN POST PARTUM DI RUANG HCU RSUD Dr. A. DADI TJOKRODIPO TAHUN 2022. Diploma thesis, Poltekkes Tanjungkarang.

WULANDARI, YERIKA (2022) ASUHAN KEPERAWATAN PERIOPERATIF PADA PASIEN CARSINOMA BULI DENGAN TINDAKAN TRANSURETHRAL RESECTION BLADDER DI RSUD Dr. H ABDUL MOELOEK PROVINSI LAMPUNG TAHUN 2022. Diploma thesis, Poltekkes Tanjungkarang.

Wahyudha, Galih Akas (2022) ASUHAN KEPERAWATAN PASIEN DENGAN GANGGUAN OKSIGENASI PADA KASUS STROKE NON HEMORAGIK TERHADAPNy. R DI RUANG SARAF RSD MAYJENDHM RYACUDU KOTABUMILAMPUNG UTARA 01-04 MARET 2022. Diploma thesis, Poltekkes Tanjungkarang.

Widiyawati, Adhaini and Manurung, Idawati and Murhan, Al (2020) PENGARUH TERAPI MUSIK TERHADAP BOUNDING ATTACHMENT PADA IBU POST SECTIO CAESAREA. Diploma thesis, Poltekkes Tanjungkarang.

Widyanti, Frisca (2022) ASUHAN KEPERAWATAN PASIEN DENGAN GANGGUAN RASA AMAN NYAMAN PADA KASUS POST OPERASI HERNIA INGUINALIS PADA An. A DI RUANG EDELWEIS RSU HANDAYANI KOTABUMI LAMPUNG UTARA TANGGAL 22 – 24 FEBUARI 2022. Diploma thesis, Poltekkes Tanjungkarang.

wulandari, fadilah (2021) LAPORAN TUGAS AKHIR ASUHAN KEPERAWATAN DENGAN GANGGUAN RASA AMAN NYERI : AKUT PADA KASUS TUMOR PARU TERHADAP Tn. T DI RUANG PARU RSUD MAYJEND HM RYACUDU KOTABUMI LAMPUNG UTARA TANGGAL 08 – 10 MARET 2021. Diploma thesis, Poltekkes tanjungkarang.

wulantika, weni (2021) ASUHAN KEPERAWATAN GERONTIK PADA Ny. A KASUS DIABETES MILITUS TIPE II DENGAN GANGGUAN RASA NYAMAN NYERI AKUT DI KELURAHAN TANJUNG AMAN KECAMATAN KOTABUMI SELATAN KABUPATEN LAMPUNG UTARA TANGGAL 23-25 MARET 2021. Diploma thesis, Poltekkes tanjungkarang.

Y

YANI, FITRI ANDRI (2020) ASUHAN KEPERAWATAN GANGGUAN KEBUTUHAN ISTIRAHAT DAN TIDUR PADA PASIEN RHEUMATHOID ARTHRITIS DI UPTD PSLU TRESNA WERDHA NATAR KABUPATEN LAMPUNG SELATAN TAHUN 2020. Diploma thesis, Poltekkes Tanjungkarang.

YANTI, HERMA (2023) HUBUNGAN DUKUNGAN KELUARGA DENGAN KONSEP DIRI PASIEN MASTEKTOMI DI RUANG KEMOTERAPI RSUD JENDRAL AHMAD YANI METRO PROVINSI LAMPUNG TAHUN 2023. Diploma thesis, Poltekkes KemenkesTanjungkarang.

YANTI, HERMA (2023) HUBUNGAN DUKUNGAN KELUARGA DENGAN KONSEP DIRI PASIEN MASTEKTOMI DI RUANG KEMOTERAPI RSUD JENDRAL AHMAD YANI METRO PROVINSI LAMPUNG TAHUN 2023. Diploma thesis, Poltekkes KemenkesTanjungkarang.

YANTI, NANDA NOPI (2023) ASUHAN KEPERAWATAN PASIEN DENGAN GANGGUAN TERMOREGULASI PADA KASUS FEBRIS TERHADAP An. N DIRUANG EDELWIS RSU HANDAYANI KOTABUMI TANGGAL 13-15 MARET 2023. Diploma thesis, Poltekkes Kemenkes Tanjungkarang.

YANTO, RISKI ROBI (2023) ASUHAN KEPERAWATAN PASIEN DENGAN GANGGUAN TERMOREGULASI PADA KASUS KEJANG DEMAM TERHADAP An.N DI RUANG EDELWEIS RS HANDAYANI KOTABUMI 15-17 MARET 2023. Diploma thesis, Poltekkes Kemenkes Tanjungkarang.

YOGI, PANDE NYOMAN SEPTIAN (2021) ASUHAN KEPERAWATAN KELUARGA LANSIA DENGAN GANGGUAN RASA NYAMAN NYERI PADA KELUARGA BPK.A KHUSUSNYA IBU.S DENGAN GOUT ARTHRITIS DI DESA RAMA GUNAWAN KECAMATAN SEPUTIH RAMAN LAMPUNG TENGAH TAHUN 2021. Diploma thesis, Poltekkes Tanjungkarang.

YOSSRANTIKA, HELEN (2021) ASUHAN KEPERAWATAN PERIOPERATIF PADA PASIEN KANKER PAYUDARA DENGAN TINDAKAN MASTEKTOMI DI RUANG OPERASI RS BHAYANGKARA POLDA LAMPUNG TAHUN 2021. Diploma thesis, Poltekkes Tanjungkarang.

YOSSRANTIKA, HELEN (2020) PENGARUH AROMATERAPI MINYAK ESSENSIAL CYTRUS (ORANGE) DENGAN INHALASI TERHADAP PENURUNAN KECEMASAN PADA PASIEN PRE OPERASI DI RUANG BEDAH RSUD Dr.H. ABDUL MOELOEK PROVINSI LAMPUNG. Diploma thesis, Poltekkes Tanjungkarang.

YUDANDI, ANGGA (2022) ASUHAN KEPERAWATAN PERIOPERATIF PADA PASIEN SINUSITIS DENGAN TINDAKAN FESS (FUNCTIONAL ENDOSCOPIC SINUS SURGERY) DI RUANG OPERASI RUMAH SAKIT BHAYANGKARA TINGKAT III BANDAR LAMPUNG TAHUN 2022. Diploma thesis, Poltekkes Tanjungkarang.

YULI, WAYAN (2023) PENGARUH EDUKASI MENGGUNAKAN MEDIA BOOKLET DAN KOMUNIKASI TERAPEUTIK TERHADAP KECEMASAN PASIEN PRE OPERASI SECTIO CAESAREA DI RSUD DR. H. ABDUL MOELOEK PROVINSI LAMPUNG TAHUN 2023. Diploma thesis, Poltekkes KemenkesTanjungkarang.

YULIA, DEVI (2020) ASUHAN KEPERAWATAN GANGGUAN PEMENUHAN KEBUTUHAN OKSIGENASI DI RUANG RPD C RSUD JEND. A YANI KOTA METRO PROVINSI LAMPUNG TAHUN 2020. Diploma thesis, Poltekkes Tanjungkarang.

YULIANA, DEWI (2022) ASUHAN KEPERAWATAN PERIOPERATIF BATU GINJAL KANAN DENGAN TINDAKAN NEFROLITOTOMI DI RSUD DR. H. ABDUL MOELOEK PROVINSI LAMPUNG TAHUN 2022. Diploma thesis, Poltekkes Tanjungkarang.

YULIANTI, RIKA (2021) ASUHAN KEPERAWATAN GANGGUAN KEBUTUHAN NUTRISI PADA ANAK. A KELUARGA BAPAK. L DENGAN GIZI KURANG DI DESA LABUHAN RATU KAMPUNG KECAMATAN SUNGKAI SELATAN KABUPATEN LAMPUNG UTARA TAHUN 2021. Diploma thesis, Poltekkes Tanjungkarang.

YUNANI, YUNANI (2021) A S U H A N K E P E R A W A T A N P E R I O P E R A T I F P A D A P A S I E N A PPE NDICI TI S D E N G A N T I N D A K A N O P E R A S I L A P A R A T O M I E K S P L O R A S I D I R U M A H S A K I T B H A Y A N G K A R A T K . I I I P R O V I N S I L A M P U N G T A H U N 2 0 2 1. Diploma thesis, Poltekkes Tanjungkarang.

YUNGAN, SHINTA PUTRI PINA (2021) ASUHAN KEPERAWATAN KASUS EFUSI PLEURA TERHADAP TN. D DENGAN GANGGUAN OKSIGENASI DI RUANG PARU RSUD MAYJEND HM RYACUDU KOTABUMI LAMPUNG UTARA TANGGAL 08-10 MARET 2021. Diploma thesis, Poltekkes Tanjungkarang.

YUNIAR, DAHLIA (2023) EFEKTIVITAS PEMBERIAN TEKNIK RELAKSASI GENGGAM JARI DAN SLOW STROKE BACK MASSAGE (SSBM) TERHADAP PERUBAHAN INTENSITAS NYERI PADA PASIEN POST OPERASI DI RUANG BEDAH RSUD DR. H. ABDUL MOELOEK PROVISI LAMPUNG TAHUN 2022. Diploma thesis, Poltekkes KemenkesTanjungkarang.

YUNIAR, ELSA (2021) ASUHAN KEPERAWATAN GANGGUAN KEBUTUHAN KEAMANAN DAN PROTEKSI: KERUSAKAN INTEGRITAS KULIT PADA LANSIA KELUARGA BAPAK M DENGAN DERMATITIS ATOPIK DI DESA BANDAREJO KECAMATAN PALAS LAMPUNG SELATAN TAHUN 2021. Diploma thesis, Poltekkes Tanjungkarang.

YUNUS, MUHAMMAD (2021) ASUHAN KEPERAWATAN PERIOPERTIF PADA PASIEN HERNIA SACROTALIS DENGAN TINDAKAN HERNIOTOMI HERNIORAFI DI RUANG IBS RSUD Dr.H. ABDUL MOELOEK PROVINSI LAMPUNG TAHUN 2021. Diploma thesis, Poltekkes Tanjungkarang.

YURI, ELITA (2023) ASUHAN KEPERAWATAN DENGAN GANGGUAN KEBUTUHAN RASA NYAMAN PADA PASIEN HIPERTENSI DI DESA PEMANGGILAN KECAMATAN NATAR KABUPATEN LAMPUNG SELATAN TAHUN 2023. Diploma thesis, Poltekkes Kemenkes Tanjungkarang.

YURISMAN, OKTO (2020) ASUHAN KEPERAWATAN GANGGUAN RESPIRASI PADA PASIEN DENGAN PENYAKIT PARU OBSTRUKSI KRONIK DI RUANG MELATI RSUD. Dr. H. ABDUL MOELOEK PROVINSI LAMPUNG TAHUN 2020. Diploma thesis, Poltekkes Tanjungkarang.

YUSNITA, NORA (2023) ASUHAN KEPERAWATAN PADA PASIEN POST OPERASI MASTEKTOMI DALAM MENGATASI NYERI AKUT DENGAN INTERVENSI TERAPI MUSIK KLASIK DI RSUDDr. Hi.ABDOEL MOLOEK PROVINSI LAMPUNG TAHUN 2023. Diploma thesis, Poltekkes Kemenkes Tanjungkarang.

YUSNITA, NORA (2023) HUBUNGAN HANDOVER DENGAN DOKUMENTASI KEPERAWATAN DI RUANG RAWAT BEDAH DI RUMAH SAKIT UMUM DAERAH ABDUL MOLOEK PROVINSI LAMPUNG TAHUN 2022. Diploma thesis, Poltekkes Kemenkes Tanjungkarang.

YUWANTRI, FADILLA (2022) ASUHAN KEPERAWATAN PERIOPERATIF PASIEN DENGAN DIAGNOSA LIMFADENOPATI AXILA SINISTRA PADA Nn.D DI RUANG OPERASI RUMAH SAKIT MARDI WALUYO METRO TAHUN 2022. Diploma thesis, Poltekkes Tanjungkarang.

YUWANTRI, FADILLA (2021) PENGARUH PEMBERIAN FOOT MASSAGE TERHADAP PENURUNAN INTENSITAS NYERI PADA PASIEN POST OPERASI SECTIO CAESAREA DI RUANG RAWAT INAP RSIA AMC KOTA METRO TAHUN 2021. Diploma thesis, Poltekkes Tanjungkarang.

Yanti, Amelsya (2022) ASUHAN KEPERAWATAN JIWA DENGAN GANGGUAN PERSEPSI SENSORI: HALUSINASI PENDENGARAN PADA KASUS SKIZOFRENIA TERHADAP Tn.A DI RUANG KUTILANG RUMAH SAKIT JIWA DAERAHPROVINSI LAMPUNG TANGGAL 15 -18 MARET 2022. Diploma thesis, Poltekkes Tanjungkarang.

Yastuti, Defi Hendri (2022) ASUHAN KEPERAWATAN PADA KASUS ANEMIA DENGAN GANGGUAN SIRKULASI TERHADAP TN. B DI RUANG PENYAKIT DALAM RSUD MAYJEND HM RYACUDU KOTABUMI LAMPUNG UTARA 22-24FEBRUARI 2022. Diploma thesis, Poltekkes Tanjungkarang.

Yulianti, Ayu (2021) HUBUNGAN TINGKAT KEPOSITIFAN BTA DENGAN NILAI LED PADA PENDERITA TB PARU (STUDI PUSTAKA). Diploma thesis, Poltekkes Tanjungkarang.

Yuliantika, Dewi (2021) ASUHAN KEPERAWATAN GANGGUAN TERMOREGULASI PADA KELUARGA BAPAK Y MEMASUKI TAHAP PERKEMBANGAN ANAK USIA PRASEKOLAH KHUSUSNYA ANAK M DENGAN THYPOID FEVER DI WILAYAH KERJA PUSKESMAS RAWAT INAP RAJABASA INDAH TAHUN 2021. Diploma thesis, Poltekkes Tanjungkarang.

Yushananta, Prayudhy and Ahyanti, Mei (2022) Bukti Korespondensi : Risk Factors of Stunting in Children Aged 6–59 Months: A CaseControl Study in Horticulture Area. Diploma thesis, Poltekkes Tanjungkarang.

Yushananta, Prayudhy and Ahyanti, Mei and Anggraini, Yetti (2022) SIMILARITY : Risk Factors of Stunting in Children Aged 6–59 Months: A Case-Control Study in Horticulture Area. Diploma thesis, Poltekkes Tanjungkarag.

Yushananta, Prayudhy and Ahyanti, Mei and Anggraini, Yetti and Sariyanto, Iwan (2021) Anemia and its Associated Factors Among Women of Reproductive Age in Horticulture Area. Diploma thesis, Poltekkes Tanjungkarang.

Yushananta, Prayudhy and Anggraini, Yetti and Ahyanti, Mei and Sariyanto, Iwan (2021) Anemia and its Associated Factors Among Women of Reproductive Age in Horticulture Area. Diploma thesis, Poltekkes Tanjungkarang.

Yushananta, Prayudhy and Anggraini, Yetti and Ahyanti, Mei and Sariyanto, Iwan (2021) Anemia and its Associated Factors Among Women of Reproductive Age in Horticulture Area. Diploma thesis, Poltekkes Tanjungkarang.

yulistina, yulistina (2021) ASUHAN KEPERAWATAN PASIEN DENGAN GANGGUAN KEBUTUHAN SIRKULASI PADA KASUS THALASEMIA TERHADAP An. I DI RUANG ANAK RSUD MAYJEND HM RYACUDU LAMPUNG UTARA TANGGAL 09 MARET 2021. Diploma thesis, Poltekkes tanjungkarang.

Z

ZAHRA, NABILA (2022) ASUHAN KEPERAWATAN GANGGUAN KEBUTUHAN CAIRAN DAN ELEKTROLIT PADA PASIEN GAGAL GINJAL KRONIK DI RUANG ICU RS BHAYANGKARA POLDA LAMPUNG PROVINSI LAMPUNG TAHUN 2022. Diploma thesis, Poltekkes Tanjungkarang.

ZAHRA, PUTRI AZ (2022) ASUHAN KEPERAWATAN GERONTIK DENGAN GANGGUAN RASA NYAMAN TERHADAP NY. S PADA KASUS HIPERTENSI DI WILAYAH KERJA PUSKESMAS KOTABUMI II LAMPUNG UTARA TANGGAL 22-24 FEBRUARI 2022. Diploma thesis, Poltekkes Tanjungkarang.

ZAHRO, ANISA FADILATUZ (2021) GAMBARAN JENIS ANEMIA BERDASARKAN INDEKS ERITROSIT PENDERITA TUBERKULOSIS PARU DI RSUD JEND. A. YANI METRO TAHUN 2019-2020. Diploma thesis, Poltekkes Tanjungkarang.

ZAKARIA, ZAKARIA (2020) ASUHAN KEPERAWATAN PERIOPERATIF PADA PASIEN HERNIA INGUINALIS DEXTRA DENGAN TINDAKAN HERNIOTOMY HERNIORAPHY DI RUANG OPERASI RUMAH SAKIT MARDI WALUYO METRO 2020. Diploma thesis, Poltekkes Tanjungkarang.

ZAKIYYAH, UMI (2023) ASUHAN KEPERAWATAN PASIEN DENGAN GANGGUAN RASA NYAMAN : NYERI PADA KASUS POST OPERASI AMPUTASI ULKUS DIABETIKUM TERHADAP TN.S DI RUANG BEDAH RSUD JENDRAL AHMAD YANI METRO TANGGAL 07-09 NOVEMBER 2022. Diploma thesis, Poltekkes Kemenkes Tanjungkarang.

ZAMIS, SITI AULIA (2021) ASUHAN KEPERAWATAN JIWA DENGAN GANGGUAN PERSEPSI SENSORI: HALUSINASI PENGLIHATAN PADA KASUS SKIZOFRENIA TERHADAP TN. A DI WILAYAH KERJA PUSKESMAS KOTABUMI II KABUPATEN LAMPUNG UTARA TANGGAL 08-11 MARET 2021. Diploma thesis, Poltekkes Tanjungkarang.

ZEIN, MEGA PUSPITA SARI (2022) ASUHAN KEPERAWATAN GANGGUAN AKTIVITAS DAN ISTIRAHATPADA PASIEN CEDERA KEPALA SEDANG DI RUANGHCURSUD Dr. A. DADI TJOKRODIPO TAHUN 2022. Diploma thesis, Poltekkes Tanjungkarang.

ZULAIKHA, SITI (2021) ASUHAN KEPERAWATAN GANGGUAN KEBUTUHAN MOBILITAS FISIK PADA KELUARGA BAPAK R DENGAN STROKE ISKEMIK DI DESA SUMBER AGUNG KEMILING BANDAR LAMPUNG TAHUN 2021. Diploma thesis, Poltekkes Tanjungkarang.

ZULFA, INDANA (2021) ASUHAN KEPERAWATAN PERIOPERATIF PADA PASIEN COLELITHIASISDENGAN TINDAKAN COLESISTEKTOMI DI RUANG OK RSUDJEND A.YANI METRO TAHUN 2021. Diploma thesis, Poltekkes Tanjungkarang.

ZULFA, INDANA (2020) PENGARUH GUIDED IMAGERY TERHADAP PENURUNAN SKALA NYERI PASIEN POST OPERASI DI RUANG RAWAT INAP BEDAH RSUD Dr. H. ABDUL MOELOEK PROVINSI LAMPUNG TAHUN 2020. Diploma thesis, Poltekkes Tanjungkarang.

ZULVIA, SAFINAH RHANY (2020) ASUHAN KEPERAWATAN PERIOPERATIF PASIEN FAM (FIBROADENOMA MAMMAE) DENGAN TINDAKAN OPERASI LOCAL EXCISION OF BREAST DI RUANG OPERASI RUMAH SAKIT MARDI WALUYO METRO TAHUN 2020. Diploma thesis, Poltekkes Tanjungkarang.

Zahroh, Latifah and Bertalina, Bertalina (2014) ASUPAN ENERGI, ASAM LEMAKTAK JENUH GANDA, KOLESTEROL DAN IMT DENGANKADAR KOLESTEROL DARAH PADA PASIENJANTUNG KORONER RAWAT JALAN. Diploma thesis, Poltekkes Tanjungkarang.

Zainaro, M.Arifki and Ridwan, M and tusinah, Rias and Aprina, Aprina (2021) TURNITIN : Physical Activity and Blood Sugar Levels in People with Diabetes Mellitus: Evidence from Indonesia. Diploma thesis, Poltekkes Tanjungkarag.

Zainaro, M.Arifki and Ridwan, Ridwan and Tusianah, Rias and Aprina, Aprina (2022) Physical Activity and Blood Sugar Levels in People with Diabetes Mellitus: Evidence from Indonesia. Diploma thesis, Poltekkes Tanjungkarang.

Zainaro, M.Arifki and Ridwan, Ridwan and Tusinah, Rias and Aprina, Aprina (2022) LAIK ETIK : Physical Activity and Blood Sugar Levels in People with Diabetes Mellitus: Evidence from Indonesia. Diploma thesis, Poltekkes Tanjungkarag.

Zainaro, M.Arifki and Sudjarwo, Sudjarwo and Hariri, Hasan and Aprina, Aprina (2022) LAIK ETIK : Exemplary Leadership Generates Trust: The Key to Success as a Preceptor for Nursing Students. Diploma thesis, Poltekkes Tanjungkarag.

Zainaro, M.Arifki and Sudjarwo, Sudjarwo and Hariri, Hasan and Aprina, Aprina (2022) TURNITIN : Exemplary Leadership Generates Trust: The Key to Success as a Preceptor for Nursing Students. Diploma thesis, Poltekkes Tanjungkarag.

Zhavira Azahra, Azahra.Zhavira (2022) ASUHAN KEPERAWATAN PASIEN DENGAN GANGGUAN NUTRISI PADA KASUS DIABETES MELITUS TIPE 2 TERHADAPNY.EDI RUANG FRESIA RSU HANDAYANI KOTABUMILAMPUNGUTARA 07 S.D 09MARET 2022. Diploma thesis, Poltekkes Tanjungkarang.

Ziani, Fitri (2022) ASUHAN KEPERAWATANDENGAN GANGGUAN RASA AMAN NYAMANPADA KASUS POST SECTIO CAESAREA TERHADAP Ny.S di RUANG KEBIDANAN RSU HANDAYANI KOTABUMI LAMPUNG UTARA TANGGAL 02-04 MARET 2022. Diploma thesis, Poltekkes Tanjungkarang.

Ziani, Fitri (2022) ASUHAN KEPERAWATANDENGAN GANGGUAN RASA AMAN NYAMANPADA KASUS POST SECTIO CAESAREA TERHADAP Ny.S di RUANG KEBIDANAN RSU HANDAYANI KOTABUMI LAMPUNG UTARA TANGGAL 02-04 MARET 2022. Diploma thesis, Poltekkes Tanjungkarang.

This list was generated on Tue Apr 23 05:40:39 2024 UTC.